KEGG   Thioflavicoccus mobilis: Thimo_1078Help
Entry
Thimo_1078        CDS       T02397                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tmb  Thioflavicoccus mobilis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tmb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tmb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1163243..1163788)
Genome map
AA seq 181 aa AA seqDB search
MNGRPAPREGARARVSLIAALARHRVIGRDNGLPWHLPADLAHFKHLTLDKPILMGRRTW
ESLPGRLERRRHIVVTRDRDYRAPGCLVVASPEAALTAVAGAAEVMVIGGAALYQAMLPL
AERLYLTEIAAEIDGDAFFPAWHPQCWRETHREFRPRDERNPYDLAFVELVRIHPDPPAA
H
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgggagacccgccccgcgcgagggtgcgcgcgcgcgcgtgagcctgatcgccgca
ctggcacgccaccgggtcatcggccgcgacaacgggctgccgtggcacctgcccgccgac
ctcgcccacttcaagcacctgaccctcgacaagccgatcctcatgggccggcgcacctgg
gagtcgctgccaggccggctggagcggcgccgccacatcgtcgtcacccgcgaccgcgac
tatcgcgcgccgggctgcctggtcgtcgcctcgccggaggcagccctgaccgcggtcgcc
ggcgcggccgaggtcatggtcatcgggggggcggccctctaccaggcgatgctgccgttg
gctgaacgcctctacctgaccgagatcgccgccgaaatcgacggcgacgccttcttcccg
gcctggcatccgcaatgttggcgcgagacccaccgtgaattccgcccgcgcgacgagcgc
aacccctacgatctcgccttcgtcgagctcgtgcggatccatccggacccgcccgcggcg
cattga

DBGET integrated database retrieval system