KEGG   Thioflavicoccus mobilis: Thimo_1110Help
Entry
Thimo_1110        CDS       T02397                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tmb00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tmb00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tmb02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198990..1200501)
Genome map
AA seq 503 aa AA seqDB search
MNRKPLTQALIGLTLLSVASHASALSGPKYVFFFLGDGMSASQIQATEAYLTTANGGDAM
VAEDLQQPENRLNMSKMSVLGMQTTYDAYALMTDSASSATAFATGVKTQSGTIGMTPDLT
QSVKSVAELAHEAGRRVAVLSSVSLNHATPAAYYASVPNRGDYYGIAEQLADSGYEFFGG
GGLNKSDQALMDYVAAQGYTVLNDRTSILNLIQDPMDKVVAINPVLPTSSAMPYAIDKPA
ENLSLAEMTEVGLATLCEGYNRWGRCKSGEPFFMMVEGGKIDWACHANDAMATIGDMRDF
DDAVAVALKFQKRHPLQTLIVVTGDHETGGMTVGHATTGYKAYYERLLDQEHSFEHFDMN
VWPDHQAKYEDGYDWGQHNNLASNPEMVTFLADEFGLVWDELNTDQQIKLEDAYDKSMVG
ENNNTADENKLLYGGYNPITVTITHILNEEASIGWTSYSHTGVPVPVFAEGREAIRFAGF
YDNTDIAKRLAKAMDLPSLPVYK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaagcccctgacgcaggcactgattggcctgacgctcttatccgtggcgtcc
cacgcctcagccctctccggcccgaagtatgtctttttcttcctgggtgacggcatgtcc
gcctcccagattcaggccactgaggcctatctgacgaccgccaatggcggcgacgctatg
gttgccgaagacctgcagcagcccgagaaccgactcaacatgtccaagatgtcggtcctg
ggcatgcagacgacctatgatgcctatgcgctcatgacggactcggcctcctccgccacc
gccttcgcgacgggcgtcaagacccagagcggcacaatcggcatgacacccgacctgacc
cagagcgtgaagagcgtcgccgagctcgcgcacgaggccggccggcgcgtcgccgtcctg
tcgagcgtgtcgctgaatcacgccacgccggccgcctactatgcgagcgtgcccaaccgc
ggcgactactacggcatcgccgagcagctcgcggactccggctatgagttcttcggcggc
ggcggcctcaacaagtccgaccaagccctcatggactacgtggcggcccagggctacacg
gtcctgaacgaccgcacctccatcctcaacctcattcaagacccgatggacaaggtggtc
gccatcaacccggtgctgccgacgagctcggcgatgccctacgcgatcgacaagccggcc
gagaacctctcgctcgcagagatgaccgaggtcggcctcgccacgctatgcgagggctac
aatcgttggggccgctgcaagagcggcgaacccttcttcatgatggtcgagggcggcaag
atcgactgggcctgccacgccaacgacgccatggcaacgatcggtgacatgcgcgacttc
gatgacgccgtcgctgtcgccttgaagttccagaaacggcatccgctgcagaccctgatc
gtcgtcactggcgaccacgagacgggcggcatgaccgtcggccacgcgaccaccgggtac
aaggcctactacgaacgcctgctcgatcaggagcacagcttcgagcacttcgacatgaac
gtctggccggaccaccaggccaagtacgaggacggctacgactggggtcagcataacaac
ctcgcgtcgaatccggagatggtcactttcctggctgacgagttcggtctcgtctgggac
gagctcaacacagaccagcaaatcaagctcgaggatgcctacgacaagtcgatggtcgga
gagaacaacaacacggcggatgaaaacaagctgctctacggcggctacaacccgatcacc
gtcaccatcacccatattctgaacgaggaggccagtatcggctggacctcgtattcgcac
accggcgtgccggtgccggtcttcgccgagggccgcgaggccatccgctttgccggcttc
tacgacaataccgacattgccaagcgcctggccaaggccatggatcttccgagcctgcct
gtctacaagtag

DBGET integrated database retrieval system