KEGG   Thioflavicoccus mobilis: Thimo_1110Help
Entry
Thimo_1110        CDS       T02397                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thimo_1110
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Thimo_1110
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thimo_1110
Enzymes [BR:tmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Thimo_1110
Exosome [BR:tmb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thimo_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1198990..1200501)
Genome map
AA seq 503 aa AA seqDB search
MNRKPLTQALIGLTLLSVASHASALSGPKYVFFFLGDGMSASQIQATEAYLTTANGGDAM
VAEDLQQPENRLNMSKMSVLGMQTTYDAYALMTDSASSATAFATGVKTQSGTIGMTPDLT
QSVKSVAELAHEAGRRVAVLSSVSLNHATPAAYYASVPNRGDYYGIAEQLADSGYEFFGG
GGLNKSDQALMDYVAAQGYTVLNDRTSILNLIQDPMDKVVAINPVLPTSSAMPYAIDKPA
ENLSLAEMTEVGLATLCEGYNRWGRCKSGEPFFMMVEGGKIDWACHANDAMATIGDMRDF
DDAVAVALKFQKRHPLQTLIVVTGDHETGGMTVGHATTGYKAYYERLLDQEHSFEHFDMN
VWPDHQAKYEDGYDWGQHNNLASNPEMVTFLADEFGLVWDELNTDQQIKLEDAYDKSMVG
ENNNTADENKLLYGGYNPITVTITHILNEEASIGWTSYSHTGVPVPVFAEGREAIRFAGF
YDNTDIAKRLAKAMDLPSLPVYK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcaagcccctgacgcaggcactgattggcctgacgctcttatccgtggcgtcc
cacgcctcagccctctccggcccgaagtatgtctttttcttcctgggtgacggcatgtcc
gcctcccagattcaggccactgaggcctatctgacgaccgccaatggcggcgacgctatg
gttgccgaagacctgcagcagcccgagaaccgactcaacatgtccaagatgtcggtcctg
ggcatgcagacgacctatgatgcctatgcgctcatgacggactcggcctcctccgccacc
gccttcgcgacgggcgtcaagacccagagcggcacaatcggcatgacacccgacctgacc
cagagcgtgaagagcgtcgccgagctcgcgcacgaggccggccggcgcgtcgccgtcctg
tcgagcgtgtcgctgaatcacgccacgccggccgcctactatgcgagcgtgcccaaccgc
ggcgactactacggcatcgccgagcagctcgcggactccggctatgagttcttcggcggc
ggcggcctcaacaagtccgaccaagccctcatggactacgtggcggcccagggctacacg
gtcctgaacgaccgcacctccatcctcaacctcattcaagacccgatggacaaggtggtc
gccatcaacccggtgctgccgacgagctcggcgatgccctacgcgatcgacaagccggcc
gagaacctctcgctcgcagagatgaccgaggtcggcctcgccacgctatgcgagggctac
aatcgttggggccgctgcaagagcggcgaacccttcttcatgatggtcgagggcggcaag
atcgactgggcctgccacgccaacgacgccatggcaacgatcggtgacatgcgcgacttc
gatgacgccgtcgctgtcgccttgaagttccagaaacggcatccgctgcagaccctgatc
gtcgtcactggcgaccacgagacgggcggcatgaccgtcggccacgcgaccaccgggtac
aaggcctactacgaacgcctgctcgatcaggagcacagcttcgagcacttcgacatgaac
gtctggccggaccaccaggccaagtacgaggacggctacgactggggtcagcataacaac
ctcgcgtcgaatccggagatggtcactttcctggctgacgagttcggtctcgtctgggac
gagctcaacacagaccagcaaatcaagctcgaggatgcctacgacaagtcgatggtcgga
gagaacaacaacacggcggatgaaaacaagctgctctacggcggctacaacccgatcacc
gtcaccatcacccatattctgaacgaggaggccagtatcggctggacctcgtattcgcac
accggcgtgccggtgccggtcttcgccgagggccgcgaggccatccgctttgccggcttc
tacgacaataccgacattgccaagcgcctggccaaggccatggatcttccgagcctgcct
gtctacaagtag

DBGET integrated database retrieval system