KEGG   Thioflavicoccus mobilis: Thimo_1296Help
Entry
Thimo_1296        CDS       T02397                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thimo_1296
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thimo_1296
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Thimo_1296
Enzymes [BR:tmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Thimo_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1415018..1416406
Genome map
AA seq 462 aa AA seqDB search
MSYCSTRGGVASVDFADAVRMGLATDGGLLVPEALPSVTPQTLGEWRRLRFQDLALEVMA
PFVGDALPRADLVELIDRSYATFAHPEVTPVVEVGDTSILELFHGPTAAFKDVALQFLGN
LFEYLLARDGGQLNIVGATSGDTGSAAIAGVRGKDRIQIFILHPQGRISPIQERQMTTVL
DANVHNVALRGTFDDGQRLVKALFNDLSFKERYQLGAVNSINWARILAQMVYYFYAWGRV
ADRLRGRPVTFAVPTGNFGDIFAGYLAKRMGLPIERLILATNRNDILTRFVASGAYATGE
VYATLSPAMDIQIASNFERYLYYLVGEDPQRVRALLDEMGRTGRLRVTGEEHAQVQRDFT
AVAVDDAATLAQIRETYETTGYILDPHTAVGVRAGAGQADLVCLATAHPAKFNEAVREAI
GCAAPAPASLRGLMDKPTRCVVLDADIAAVRDYIGEALAARP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagttactgtagtacccgcggcggtgtggcgtcggtcgatttcgccgacgcagtccgg
atggggctggcgaccgatggtggtctcctcgtccccgaggcgctgccgagcgtgacgccg
cagaccctcggtgagtggcgacggctgcgcttccaggacctggccttggaggtgatggcg
ccgttcgtcggtgatgccctgccgcgtgccgacctggttgaattgatcgatcgttcctac
gcgaccttcgctcaccccgaggtcacgccggtggtcgaggttggcgatacttcgatcctg
gagctgttccacggcccgacggccgccttcaaggacgtcgccttgcagttcctcggcaac
ctatttgaatatctgctcgcgcgtgacggcgggcagctcaacatcgtcggtgccacctcg
ggcgacacgggttcggccgccatcgccggggtgcgcggcaaggatcgtatccagatcttc
atccttcacccgcaggggcgcatctcgccgatccaggaacggcagatgacgacggtgctc
gacgcgaacgtgcacaatgtcgcgctgcgcggcacgttcgatgacggtcaacggctggtc
aaggccttgttcaacgacctgtcgttcaaggaacgctaccagttgggagcggtgaattcg
atcaactgggcgcgcatcctcgcccagatggtctactacttctatgcgtggggacgcgtc
gccgaccggctccggggacggcctgtgacctttgcggtgccgaccggcaatttcggcgac
atcttcgccggctatctcgccaagcgcatgggtctgccgatcgagcggctgatcctggcc
accaatcgcaacgacatcctgacccgtttcgtcgcctcgggcgcctacgccactggcgag
gtctatgcgaccctgagtccggcgatggatatccagatcgcttcgaacttcgaacggtat
ctctactatctggtcggtgaagacccgcagcgggtgcgggcgctgctcgatgagatgggt
cgcactgggcggttgcgcgtgaccggcgaggagcatgcccaggtgcagcgcgatttcacc
gccgtcgccgtcgacgacgcggcgaccctcgcccagatccgcgagacctatgagacgaca
ggttacatcctcgatccgcacaccgccgtcggcgtgagggccggtgccgggcaggcggat
ctcgtctgtctcgcgacggcccatccggccaagttcaacgaggcggtgcgcgaggcgatc
ggctgcgcggcaccggcgccggcgagcctgcgcgggctgatggacaaaccgacgcgctgc
gtggtcctcgatgccgatatcgccgcggtacgcgactatatcggagaggccctggcggcg
agaccctga

DBGET integrated database retrieval system