KEGG   Thioflavicoccus mobilis: Thimo_1317Help
Entry
Thimo_1317        CDS       T02397                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00330  Arginine and proline metabolism
tmb00332  Carbapenem biosynthesis
tmb01100  Metabolic pathways
tmb01130  Biosynthesis of antibiotics
tmb01230  Biosynthesis of amino acids
Module
tmb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thimo_1317
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Thimo_1317
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Thimo_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGA90112
UniProt: L0GWA8
Position
1437906..1439030
Genome map
AA seq 374 aa AA seqDB search
MLTRAKLSRTRCWVVKIGSALLTRNGQGLDRHVLEPWADQIAARRIGGDDLVLVSSGAVA
EGMARMGWTRRPRALHELQAAAAIGQMGLVRAYEDCFAKRGLHTAQVLLTREDLADRRRY
LNARSTLRALLKLGVIPVVNENDTVATDELRFGDNDTLAALVANLIEAEVLVLLTDQEGL
FDSDPRFNSEARLIGERRVDDSSLDLAAGESAGGLGRGGMVTKVRAARLAARSGTATVIA
AGIGDQVLTRIGHGEPIGTLLVPSQEPQTARKQWLAGQLQARGRVTLDDGAVRALRERGT
SLLAVGVRAVEGRFKRGEVVACVDATGRQIARGLINYDADETARIMGQPSAHFEEILGYL
VEPELIHRDNLVLL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgcgcgcgaagctctcccgcacccggtgctgggtcgtcaagatcggtagcgcc
ctgctgacccgcaacggccaggggctcgaccgccacgtgctcgagccctgggccgatcag
atcgccgcgcggcgcatcggcggcgacgatttggtgctggtttcctccggggccgtcgcc
gagggtatggcgcggatgggctggacgcgtcggccgcgggccctgcacgagctccaggcg
gccgccgcgatcggtcagatgggcctggtgcgggcctatgaggactgcttcgccaagcgc
ggcctgcacacggcgcaggtgctcctgacgcgcgaggacctcgccgatcggcgccgctac
ctgaatgcccgcagtaccctgcgcgcgctgctcaagctcggtgtcatcccggtcgtgaac
gagaacgacacggtggcgaccgacgagttgcgtttcggcgacaatgacacgctggcggcg
ctggtcgccaacctgatcgaggccgaggtcctcgtgttgctgaccgaccaagagggcctg
ttcgacagtgacccgcgcttcaactcggaggcgcggttgatcggtgagcggcgcgtcgac
gattcgtcgctcgacctcgctgccggcgagagcgccggcggtcttggacgtggtggcatg
gtgaccaaggtgcgggcggcccggctggcggcccggtccggcaccgcgaccgtcatcgcc
gccggcatcggtgatcaagtgctgacgcgcatcggccatggcgagccgatcggcaccctg
ctggtgccgtcccaggagccgcaaacggcacgcaagcagtggctggcgggccagctccag
gcgcgcggccgcgtgaccctggacgacggcgcggtgcgggcgttgcgcgagcggggcacc
agcctgctcgccgtcggcgtgcgggccgtcgagggtcgcttcaagcgcggcgaggtcgtt
gcgtgcgtcgacgccaccgggcggcagatcgctcgcggtctgatcaactacgatgccgac
gagaccgcccggatcatgggccagccgagcgcgcacttcgaggagatcctcggctatctc
gtggagcccgagctgatccaccgagacaacctggtcctgctctga

DBGET integrated database retrieval system