KEGG   Thioflavicoccus mobilis: Thimo_1330Help
Entry
Thimo_1330        CDS       T02397                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tmb  Thioflavicoccus mobilis
Brite
Enzymes [BR:tmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Thimo_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1449628..1450299
Genome map
AA seq 223 aa AA seqDB search
MQLTSASDAEELGMTSQPARERLTERLRRMGISHPEVLEVMGRMPRHSFVDEALASRAYD
DSALPIGWGQTISQPYIVARMTEILLAGPRRDRVLEIGTGSGFQTAVLASLVRRVYSVER
VADLKEQAERRLRALKLRNVRLRHGDGAQGWPEYAPFDGILVTAAPPRVPRLLADQLGCG
GCMVTPIGTAPEQFLLRLVRTRSGWRHEMLEPVSFVPFLEGTC
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgcaactgacctctgccagcgatgcggaggagctcggcatgacctcgcagcccgctcgc
gagcgcctcacggagcggctgcgccgcatggggatcagccatccggaggtgttggaggtg
atgggccgcatgccgcgccattccttcgtcgacgaggcgctggcgagccgcgcctacgac
gactcggcactgccgatcggttgggggcagacgatttcgcagccctatatcgtcgcgcgg
atgacggagatcctgctcgccggtccgcggcgcgaccgggtgctcgagatcggtaccggc
tcggggttccaaacggccgtgctggcctcgctggtgcgccgcgtctacagcgtcgagcgg
gtcgccgacctcaaggagcaagccgagcggcggctgcgggcactgaaactgcgcaatgtg
cggttgcgccacggcgatggcgcgcagggctggccggaatacgcgccattcgatgggatc
ctcgtgacggcggccccgccacgcgtgccacgcctgctggccgatcagctgggttgcggg
ggctgcatggtcacgccgatcggaacggcgccggagcaattcctgctgcgcctggtgcgc
acccgaagcggttggcggcacgagatgctggagccggtcagcttcgtcccatttctcgag
ggcacctgttga

DBGET integrated database retrieval system