KEGG   Thioflavicoccus mobilis: Thimo_1360Help
Entry
Thimo_1360        CDS       T02397                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thimo_1360
Enzymes [BR:tmb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Thimo_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1479150..1479923
Genome map
AA seq 257 aa AA seqDB search
MTTTGRLAGRGVLVTRPAAQAERLCGLIEAAGGRAIRLPVLDIEPAADPAPLCRLFAERW
DLLVFVSRNAVELALALLPAGRLPTGPRLAAVGRATAEALAAAGRGPDLVPAGRYDSETL
LALPELADVRGWRVLIVRGEGGRALLRDTLASRGAEVAYAEVYRRVLPSVDVGTLVARWD
EEVAVTMATSDEALQNLLTLVGPAGRAALLATPLVVVAERTGELAGRLGFGEVAVAERAD
DGSILAACCALVGSVAR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccggccggttggccgggcgtggcgtgctggtgacacgcccggcggcacag
gccgagcgcctctgcggcctgatcgaggcggccggcgggcgggcgatccgcctcccggtg
ctcgacatcgagccggccgccgacccggcgccgctgtgccgcctcttcgccgagcgttgg
gacctgctcgtcttcgtcagccgcaatgcggtcgagctggccctggcgctgctgccggct
ggacgtttaccgaccgggccgcggctggccgccgtcgggcgggcgacggccgaggcactg
gccgcggccgggcggggcccggatttggtgccggccgggcgctacgacagcgagacgctg
ctcgcgctgcccgaactcgccgacgtgcgcggctggcgcgtgctgatcgtgcgtggtgaa
ggcgggcgcgccctgcttcgcgacacccttgccagtcgtggcgccgaggtcgcctacgcc
gaggtctatcgccgcgtcctgccgagcgtcgacgtcggcaccctcgtcgctcgctgggac
gaggaggtcgccgtcacgatggccacgagcgacgaggccttgcagaatctgctgacgctc
gtcggccccgcgggccgtgccgccctgctcgccactccgctcgtcgtggtcgccgagcgc
accggggagttggccggtcggcttggcttcggtgaggtcgcggtcgccgagcgtgccgac
gacgggtcgatcctcgcggcctgctgtgcactggtcggttccgtcgcacgctga

DBGET integrated database retrieval system