KEGG   Thioflavicoccus mobilis: Thimo_1384Help
Entry
Thimo_1384        CDS       T02397                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Thimo_1384
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thimo_1384
  Lipid metabolism
   00071 Fatty acid degradation
    Thimo_1384
  Amino acid metabolism
   00350 Tyrosine metabolism
    Thimo_1384
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Thimo_1384
   00626 Naphthalene degradation
    Thimo_1384
Enzymes [BR:tmb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Thimo_1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
join(1504836..1505189,1505191..1505847)
Genome map
AA seq 336 aa AA seqDB search
MKAMVIHRIAPLRDGEGPLALRDLPIPEPGPGEILVRVAACGVGHTELDEIEGRTAPPRL
PVVPGHEVVGRVSRCGPGATRFAVGDRVGVGWIHSSSGAVDENLSADFRATGRDVDRGNT
EYMRVPEAYAYPIPDVFTDAQAAPLLCAGGVGYRSLRLTGIADGQRLGLTGFGGSAHLVL
QLARHLYPNTPIYVFARDPGARAFALELGAVWAGATAERAPEPLHAVIDTTPAWTPVVEA
LANLAPGGRLVINAIRKEDTDQDALLRLRYQDHLWLEREIKSVANVTGRDLAEFLPIAAE
IPLRPVVQTYPLEEANRARCDLKYRPVRGAKVLLID
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgatggtcatccatcggatcgcgccgctgcgtgatggtgaagggccactcgcg
ctccgcgatctgccgattcccgaacccgggcccggcgagatcctcgttcgggtcgccgcg
tgtggcgtcggtcacaccgagctcgacgagatcgagggccgcactgcaccgcccaggctc
ccggtcgtgccgggtcacgaggtggtcgggcgggtgagccgctgtgggccgggcgcgaca
cggttcgccgtcggcgaccgggtcggcgtcggctggatccattcctcgtccggggcggtg
gacgaaaacctgagcgccgatttccgggccaccggccgtgacgttgaccgcggcaacacc
gagtacatgcgagttcccgaggcctatgcctatccgatccccgacgtcttcaccgatgcc
caggcggcgccgctcctctgcgccggcggggtcggctatcgttcgctacgtctgaccggg
atcgccgacggccagcggctgggcctgactggtttcggcggctcggcgcacctggtgctc
caactcgccaggcatctctacccgaacacgcccatctacgtcttcgcccgggatcccggg
gcgcgggccttcgcgctggagctcggcgccgtctgggcgggcgcgacggccgagcgggca
cccgagccgctacatgccgtgatcgacacgacaccggcctggacaccggtcgtcgaggcc
ttggccaatctcgcaccgggtgggcgcctcgtcatcaacgcgatccgcaaggaagatacg
gaccaggatgcgctcttgcggctgcgctaccaggatcacctgtggctggagagggagatc
aagtcggtggccaacgtcaccggccgcgacctcgccgagttcctcccgatcgcggcagag
atcccgctgcgcccggtcgtgcaaacctatccgctcgaagaggcgaaccgcgcccgctgc
gacctgaaataccgtcccgtccgcggagccaaggtgctgctgatcgattga

DBGET integrated database retrieval system