KEGG   Thioflavicoccus mobilis: Thimo_1481Help
Entry
Thimo_1481        CDS       T02397                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tmb  Thioflavicoccus mobilis
Brite
Enzymes [BR:tmb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Thimo_1481
Secretion system [BR:tmb02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Thimo_1481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1633610..1634353
Genome map
AA seq 247 aa AA seqDB search
MSRFARLPSVAPALIFGLAVGLGQPAFADGPAKIRKSLETLLPDIKIDSIERSPIDGLYE
VLVGTQLMYVTGDGRYYIDGRIVDLEKRVDLTEPRLAAARLKAVERVGEDNMIIFEPPGK
TKHTVTVFTDIDCGYCRKLHKQIDGYGEEGIRIRYLFFPRAGKGSPSYDEAVSVWCSDDR
QAAMTAAKSGKVIQDKQCPNPVDRHLALGHEMGIRGTPALLLESGDLVPGYVAPEQLAAM
LDQASGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagattcgcccgattgccatccgtcgcccccgcattgatcttcggcttggccgtc
gggttggggcagcccgccttcgccgacggtcccgccaagatccgcaaatccctggaaacg
ctcctgccggacatcaagatcgatagcatcgagcgttcgccgatcgatggcctctacgag
gtcctcgtcggtacccagctgatgtacgtgaccggcgatggccgctattacatcgatggg
cggatcgtggacctggaaaagcgggtagatctgaccgagccgcgtctcgccgcggcgcgc
ctgaaggctgtcgagcgggtcggcgaggacaacatgatcatcttcgagccgcccggaaag
accaagcacacggtcactgtcttcaccgatatcgattgcggctactgtcgcaagctccat
aagcagatcgacggctacggcgaggaaggcatccgcatccgctacctcttcttcccgcgc
gccggcaagggcagcccgtcctatgacgaggcggtctcggtctggtgctccgacgatcgg
caagctgcgatgacggcagccaagtcgggcaaggtgatccaggacaagcagtgcccgaat
ccggtcgatcggcatctggccctcggccacgagatggggattcgcggcacaccggcgttg
ctcctggaatccggcgacctggtgccgggttacgtcgcccccgagcagctggccgcgatg
ctcgaccaggcgagcggcaattga

DBGET integrated database retrieval system