KEGG   Thioflavicoccus mobilis: Thimo_1566Help
Entry
Thimo_1566        CDS       T02397                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Thimo_1566
Enzymes [BR:tmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Thimo_1566
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Thimo_1566
Lipid biosynthesis proteins [BR:tmb01004]
 Fatty acid synthase
  Component type
   Thimo_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1723729..1724340
Genome map
AA seq 203 aa AA seqDB search
MLLLPSFSPLAHAEERPVILILGDSLSAGYGLVHPSDGWVAMLEARLRETGSQYRVVNAS
ISGETTAGGLTRLPALLEREGPELVIIQLGANDGLRGLDLDRMATNLHELIERSRSAGSR
VLLVGNRLPPNYGAAYTQRFQAVFEAVAAEARVPLVPALLAGVAEHWDLMQPDGVHPTAR
AQPQLLANVWRVLAPLLDVNVAR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctgttgccatcattttcgccgttggcgcatgccgaggagcgccccgtgatcctg
atcctcggcgacagcctgagtgccggttatggccttgtgcacccgagcgacggttgggta
gcaatgctcgaggcgcggctgcgcgagacagggtcgcaatatcgcgtcgtcaacgcgagc
atctccggggagacgacagcgggcggccttacacggttgccggccctgctggagcgcgag
ggcccggaattggtgatcatccagctcggggccaacgatggactgcgcggtctcgacctg
gaccggatggccaccaatcttcatgaattgatcgagcggtcacggtccgccggaagtcgg
gtactgctggtcgggaatcgcctgccgccgaactacggtgcggcctacactcagcgcttt
caagccgtgttcgaggccgtcgccgccgaggccagggtgccgctggtaccggcgctcctc
gcgggagtcgccgagcattgggacctgatgcagccggacggcgtgcatccgacagcccgg
gctcagccgcagctgctcgcaaacgtttggcgcgtattggcgccgctgctggatgtcaat
gtcgctcgctga

DBGET integrated database retrieval system