KEGG   Thioflavicoccus mobilis: Thimo_1570Help
Entry
Thimo_1570        CDS       T02397                                 

Definition
PAS domain-containing protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tmb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tmb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1727384..1732933)
Genome map
AA seq 1849 aa AA seqDB search
MVEKDGREANSDRAEDKVSPTLEEAAPLGEGAQSSDSTDRETDATAEGHLIPEPRRSCVV
VGVGASAGGLSAFKRFLRSLPSDSGMAFVLIQHLDPSHESMMAELLSKYTTMPIVQIDEA
MPIEPNTVYMIQPNRFVKIEDNGLFVEAPVQRRGVRLPIDYFFSSLARARRERAICVVLS
GTGSDGADGLREVKGEGGMTIAQRTEDAEFDGMPSAAVATGAVDHVLAIEEMADAILAYS
RHAYVHNHSNGTLASAAPEHFRAILSLLNARTERDFSRYKHGTLARRIERRMGIRHIDSA
ADYLKLLRSDQEEVHALFKDLLIGVTRFFRDPAAWSELEHILAHQLRDRRSEEAVRVWVP
GCATGEEAYSIAMLLFELQERQNKRWDIQVFATDIDSDAIEAARFGLYSENIASDLTEAR
LTAFFQHDGNKLRVKKRLRETCVFAVQSLLSDAPFSNLDLISCRNLLIYLESDIQQRVLD
VFHFGLKPSGLLFLGNSESPNKRIRLFKTLSQPSRVYQKVGTSRPGSGGFPVVSTSRRCL
DTLPAKRDEQQSVALGAIERSKRALLEEFAPASVVVNYRGLIQYIHGPVRNYLDFPSGEP
ELELTTMTLEGLKAKTRSALHQARTSGETVSLVATRIQRDREETAVRIRAQPLPGGKGDD
RLFLVSFLDESPPQAADHSADADVPEAPAGLRGSDADEVNRQLVLELAATREDLQSTIEE
LESANEELKASNEEVMSMNEELQSTNEELETSREELQSLNEELSTVNSQLHDKVGELEAM
TNDLTNLLASTDVATLFLDEGLRIRRFTPATMRLMSLLDSDVGRPLSDLASRVDDPELAD
DARAVLQTLAPIQKEVSKGSSQWFMRRVTPFRTADNKIEGVVVTYSDVTGVKEAARHVEL
REQQQAAVAQFGRAALAGEDSEALLGRAAKMVVDTLEVDYVKVLRREPEGRDLRLVAGVG
WRNGLVGEATVSAGIESQGGYTLQTGGPVVTRDLRKEKRFSGSRLMSDHGILSGMSVLIG
PEEAPWGVLSAHARREIDFTVDDTNFMLSVANVLWEAIRREAVETALRANEARTAAFLNN
SAVVAWMKDGRGRYVYLSQTFEHRFGIRADDWLGRTDEELWPPEMAAAIHANDRRVREAN
EALETTETMVVRSGASVHLLVSKFPFTDALGRSCVGGLGVDITDRIEAERALTESEERLR
QAARMARFGTYYADVDEGVIYWSAELKEILGYPSDAALETAIGEVPGFVNEADRERVAAA
LTASLDPVGDGLLQEEYRVVRRDGEIRWLLMQGRTLFQGEGPARCPIQVTGTALDITERH
LFEEELRAARTRAEAANEAKSQFLANMSHEIRTPLTAILGFADVLQTRLCDPDDQACINT
IKRNGDHLRQILDDFLDLAKIEAGKLSVHAQPCDAVAIIVEIQSLYGARAAQKGLSLTFE
PRGELPRQIETDPKCLRQILLNLVGNAIKFTDTGGVQIVVECHAQDEQLAIAVIDSGIGI
EQSHLEAVFEAFEQLDKSMTRSAGGTGLGLSITKKLVRALGGEITAESEPEHGSTFHIRI
PTGPLAEAEWVIPDVTRLPTGAGGSPNEALPTLKARVLAVDDHRDVRFLVHELIENAGGE
VISASDGAQALAVWQREHGQGRTIDAVLIDIQMPGMDGLDTTRQLRAVGCRVPIIALTAN
AMQRDRDACLEVGCDDFLSKPIERAVLLKKLAGWLHQPLADRTDDEATLVVLCVDDDPDI
RATQKTLLELHGHRVEVAGSGAEALAVAERCKPSTALIDLGLGDMSGSELLEQLKRRPEL
ADCLYVCLSGQTEDEAAWRELGFDYYLQKPVGIAALTEVLRCAKPGTKE
NT seq 5550 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaaaaagatggccgcgaggccaactcggacagagctgaagacaaggtgtcacca
acgctcgaagaggccgccccgctcggtgaaggcgcccagtcctccgattcgaccgaccgc
gagaccgacgccaccgccgaggggcacctgattcccgagccaaggcgcagctgcgtcgtc
gtcggcgtcggcgcctcggccggcggcctgagcgcgttcaagcgctttctgcgcagcctc
ccgagcgactccggcatggccttcgtgctgatccagcacctcgacccttcccacgagagc
atgatggcggagctgctctcgaagtacacgacgatgccaatcgtgcagatcgacgaggcg
atgccgatcgagccgaacaccgtgtacatgatccagccgaaccggttcgtcaagatcgag
gacaacgggctgttcgtcgaggcgccggtgcagaggcgcggcgtgcgcctgccgatcgac
tacttcttcagctcgctggcgcgggcgcgacgcgagcgggcgatctgcgtcgtcctctcc
ggcaccggcagcgacggcgccgacggcctgcgcgaggtcaagggcgagggcggtatgacg
atcgcacagcgaacggaggacgcggagttcgacggcatgccgagcgccgccgtcgccacc
ggcgccgtcgatcatgtgctcgcgatcgaggagatggccgacgcgatcctggcctacagc
cgccacgcctacgtccacaatcactcgaacggcaccctggccagcgcggcgcccgagcac
ttccgcgccatcctgagcctgctgaacgcccggaccgaacgtgacttcagccgctacaag
cacgggaccctcgcgcggcgcatcgagcggcgcatgggcatccggcacatcgacagcgcc
gccgactacctcaagctcctgcgcagcgaccaggaagaggtacacgccctgttcaaggac
ctgctcatcggcgtgacccgttttttccgcgatccggcggcctggagcgagctggagcat
atcctggcgcaccaattgcgcgaccgccgcagcgaggaggccgtgcgggtctgggtgccg
ggctgcgcgaccggcgaggaggcctattcgatcgcgatgctgctgttcgagctccaggag
cggcagaacaaacgctgggacatccaggtgttcgccaccgacatcgacagcgacgccatc
gaagctgcccgcttcggcctctactcggagaacatcgccagcgacctcaccgaggcgcgc
ctcacggccttcttccagcacgacggcaacaagctacgcgtcaagaagcgcctgcgcgag
acctgcgtcttcgcggtgcagagcctgttgtcggacgcgcccttctccaacctcgacctg
atcagctgccgcaacctactgatctatctcgagtcggacatccagcaacgggtgttggac
gtcttccacttcggcctcaaaccgagcggcctgctgtttctgggcaactcggagtcgccg
aacaagcggatcagactcttcaagaccctctcgcagccctcgcgggtctaccagaaggtc
ggcaccagccgcccgggcagcggcggcttccctgtggtgagcacgagccgccgctgcctc
gacacgctgcccgcgaagcgcgatgagcaacagagcgtcgcgctcggggccatcgagcgc
tccaaacgggccctactcgaggagttcgcgccggcgtccgtcgtcgtcaactaccgcggt
ctgatccagtacatccacggaccagtgcgcaactatctcgacttcccgagcggcgagccg
gagctggagctcaccacgatgacgctcgaggggctcaaggccaagacgcgcagcgccctg
catcaggcccgcacatccggggagacggtctcgctggtggcgacgcggattcagcgtgat
cgcgaggagaccgccgtgcgcatccgcgcgcagccgctgcccggcggcaagggcgacgat
cgactcttcctggtcagctttctcgacgagtctcccccacaggcggcagaccactcggca
gacgcggacgtcccggaggcgccggcaggcctccgggggagcgacgcggacgaggtcaac
cgccaactggtgctggaactcgcggcgacacgggaggacttgcagagcacgatcgaggag
ctcgagagcgcgaacgaggagctcaaggcctcgaacgaagaggtcatgtcgatgaacgag
gagctccagtcgacgaacgaggagctggagacctcgcgcgaggaactgcaatcgctcaac
gaggagctcagcacggtcaacagccagctacacgacaaggtcggcgagctggaggcgatg
accaacgacctgaccaacctcctcgcgagcaccgacgtggcgaccctgttcctcgacgag
ggcctgcgtatccgccgcttcacgccggcgaccatgcgcctgatgagcctgctcgacagc
gacgtcggccggccgctgagcgatctggcctcgcgcgtcgacgacccggaactcgccgac
gatgcccgtgccgtgctccaaaccctggcgccgattcagaaggaggtcagcaaaggctcc
tcacagtggttcatgcgccgcgtgacgcctttccggaccgcggacaacaagatcgaaggg
gtggtcgtcacctactcggacgtcaccggcgtcaaggaggcggcgcgacacgtcgagctg
cgcgagcagcagcaggcggccgtcgcccaattcggccgtgcggccctcgccggcgaggac
tccgaggcgttgctcggacgggctgcgaagatggtcgtggacacgctcgaggtcgactac
gtcaaggtgctgcgccgcgagcccgagggccgcgacctgcgcctggtcgccggtgtcggc
tggcgtaacggactggtcggcgaagcgaccgtctcggccggaatcgagtcccagggcggc
tacacgctgcagaccggcgggccggtcgtcacgcgcgacctgcgcaaagagaagcgcttc
agcggctcgcggctaatgagcgaccacgggatcctgagtggcatgagcgtcctgatcggc
ccggaagaggccccatggggcgtcctcagcgcccatgctaggcgcgagatcgacttcacc
gtcgacgacaccaacttcatgctgtcggtcgccaacgtgctctgggaggcgatccgccgc
gaggccgtggagacggcactgcgggccaacgaggcgcgcacggcagccttcctgaacaac
agtgccgtcgtcgcctggatgaaggacggtcggggccgctacgtctatctgagccagacc
ttcgagcaccgtttcgggatccgcgccgacgactggctcggccggacggacgaagagctc
tggccgccggagatggccgcggccattcacgccaacgatcgacgggtacgcgaggccaac
gaggccctggagacgaccgagaccatggtcgtccgcagtggggcgtcggtgcacttgctg
gtctccaagttccccttcaccgatgccctgggtcggtcctgcgtcgggggtctgggcgtc
gacatcaccgaccgcatcgaggccgagcgggcgctgacggagagcgaggagcgcctgcgc
caggcggcccgcatggcacgcttcggcacctattacgccgatgtcgatgaaggcgtcatc
tactggtcggccgaactcaaggagatcctcggctatccctcggacgcggcgctcgagacc
gccatcggcgaagtgcccgggttcgtgaatgaagccgaccgcgagcgcgtggccgccgcc
ctcaccgcgagcctcgaccccgtcggcgacggactgctgcaagaggagtaccgggtcgtg
cgccgcgacggcgagatccgctggctgctgatgcagggccggaccctgttccagggtgaa
ggtccggcgcgctgccccatacaggtcacaggtacggcgctggatatcaccgagcggcat
ctgttcgaggaggagctgagggccgcgcggacccgagccgaggcggcgaacgaggccaag
agccagttcctcgccaacatgagccacgagatccgcacgccgctgaccgcgattctgggc
ttcgccgacgtcctgcaaacgcgcctctgcgatcccgacgaccaggcctgcatcaacacc
atcaagcgcaacggcgatcacctgcgccagatcctcgacgacttcctcgacttggccaag
atcgaggccggaaagctcagcgtccacgcccagccctgcgacgcggtcgcgatcatcgtc
gagatccagtcgctctacggtgcccgcgccgcgcagaagggcttgtcgctgaccttcgag
ccacgcggcgagctgccgcgccagatcgagacggatcccaagtgcctgcgccagatcctg
ctcaacctggtcggcaacgcgatcaagttcaccgacaccggcggggtgcagatcgtcgtc
gagtgccacgcccaggacgagcaactcgcgattgcggtcatcgactccgggatcgggatc
gagcagagccatctcgaggcggtcttcgaggccttcgagcaactcgacaagtccatgacc
cgcagcgcaggcggcaccggcctcggcctgtcgatcacgaagaagctggtcagggcactc
ggcggagagatcacggccgagagcgagcctgagcacggctcgaccttccacataaggatc
ccgaccgggcccctcgccgaggccgaatgggtgataccggatgtcacgcggctccccacc
ggcgcaggcggatcaccgaacgaggcgctgccaacgctcaaggcgcgcgtgctcgccgtc
gacgaccatcgcgacgtccgcttcctcgtccacgagctgatcgagaacgccggcggcgag
gtcatctcggccagcgacggcgctcaggccctcgccgtctggcagcgcgagcatggccag
gggcgcaccatcgacgcggtgctgatcgacatccagatgccgggcatggacggcctcgat
acgacacggcagcttcgagcggtcggctgtcgcgtgcccatcatcgcgttgaccgccaac
gcgatgcaacgcgatcgtgacgcctgcctcgaggtcggctgcgacgatttcctgagcaag
ccgatcgagcgcgccgtgctgttgaagaaactggccggctggctgcatcagccgctggcc
gaccgcaccgacgacgaggcgacgctcgtcgtcctctgcgtcgacgacgaccccgacata
cgcgcgacccagaagaccctgctggagctacacggccatcgcgtcgaggtcgccggctcc
ggtgccgaggccctcgccgtcgccgaacggtgcaagccgagcaccgccctcatcgatctc
gggctcggcgatatgtcaggcagcgaactgctcgaacagctcaagcgccgccccgaactc
gccgactgcctgtacgtctgcctctccgggcagacggaagacgaagcggcatggcgggag
ctcggcttcgactactacctccaaaagccggtcggcatcgcggcactcaccgaggtgctg
cgatgtgccaaacccgggaccaaggaatag

DBGET integrated database retrieval system