KEGG   Thioflavicoccus mobilis: Thimo_1571Help
Entry
Thimo_1571        CDS       T02397                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thimo_1571
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Thimo_1571
Enzymes [BR:tmb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Thimo_1571
Two-component system [BR:tmb02022]
 CheA family
  CheA-CheYBV
   Thimo_1571
Bacterial motility proteins [BR:tmb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Thimo_1571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1733432..1734565
Genome map
AA seq 377 aa AA seqDB search
MRRIILMGASSGGTEALTEVLKGLRPGLAAAIFVVRHVPGDSVNFLPQLLARDCPLPVCL
AANGETFRAGTVYVAPADHHLLVDTDQMFLSRGPRENRARPAIDPLFRSAALAFGPRAVG
VVLSGSLDDGTAGLVAVKRSGGIAVVQEPADALNPDMPQSALHYVEADHCLPAAEIGPLL
VRLVATEISTAVPEAIEHLQAGWRREVAIQRHETGTVAGAAELGELFPASCPECGGPLWE
MKDGVPRYRCHTGHALTARHLVEGLGQAAEEALWAALRVLEERSRMLRRIGQQDAERGRD
ASQRAFAERAAETDRYVATLRELLKAVPPVGGDSSLALGGGRHVPGVPVIEERQTDDTDG
SDPHATDPPLGPELSGS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcggatcatcttgatgggggcctcgagcggcggtaccgaggcgcttaccgaggtc
ctcaaggggctgcggccgggtctcgcggcggccatcttcgtcgtgcgccacgtgccgggc
gattcggtcaattttctgccgcagctgctcgcccgcgactgcccgctcccggtgtgcctg
gcggccaacggcgagacgttccgtgcgggcaccgtctatgttgcaccggccgatcaccac
ctgctcgtcgacaccgatcagatgttcctgagccgtgggccgcgtgagaatagggcccgt
ccggcgatcgatccgcttttccgctccgcagcgctcgcgttcggtccccgggccgtcggg
gtcgtgctctccgggagtctcgacgacggcaccgccgggttggtcgccgtgaagcgcagc
ggtggcatcgccgtcgttcaggagccggccgacgccttgaatccggatatgccgcagagc
gcgctgcactacgtggaggccgaccactgtctgccggccgccgagatcggtccgctgctg
gtgcgcctcgtggcgacggagatctcgaccgcggtgcccgaggccatcgagcacctgcaa
gccggctggcgccgcgaggtcgcgattcagcgccatgagaccgggaccgtggcgggcgcc
gccgagctcggcgagctgtttccggcgagctgcccggagtgtggcgggccgctttgggag
atgaaggacggtgtgccccgctatcgctgtcataccggtcatgcgttgactgcccgccac
ttggtcgagggactggggcaggccgccgaggaggctctgtgggcggcgctccgggtcctc
gaggagcggtcccgcatgctgcgccgcatcggccagcaggacgccgagcgcggccgcgac
gcatcccagcgggccttcgccgagcgcgccgcggagacggaccgatacgttgcgacccta
cgcgaactcctgaaggcggtgccgcccgtcggcggggattccagtctggcactgggaggt
ggccggcatgtgcccggcgtgccggtgatcgaagaacggcaaaccgacgacaccgatggc
tccgatccgcatgccaccgatccccctttggggccggagttgtcgggttcctga

DBGET integrated database retrieval system