KEGG   Thioflavicoccus mobilis: Thimo_1713Help
Entry
Thimo_1713        CDS       T02397                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00040  Pentose and glucuronate interconversions
tmb00052  Galactose metabolism
tmb00500  Starch and sucrose metabolism
tmb00520  Amino sugar and nucleotide sugar metabolism
tmb01100  Metabolic pathways
tmb01130  Biosynthesis of antibiotics
Module
tmb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thimo_1713
   00052 Galactose metabolism
    Thimo_1713
   00500 Starch and sucrose metabolism
    Thimo_1713
   00520 Amino sugar and nucleotide sugar metabolism
    Thimo_1713
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thimo_1713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AGA90490
UniProt: L0GYQ2
Position
1894508..1895383
Genome map
AA seq 291 aa AA seqDB search
MARIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAADEAEGGGAEQLVFITGRN
KRSIEDHFDKAYELEMELEGAGKQKLLEIVQNLLPAHVSCIYLRQAEALGLGHAVLCARP
VVGDEPFAVILADDLIQGEGQGVIAQMVEVYERFGCSVLGVEEVPRQETNKYGIVATETG
PDGELRVTSMVEKPAPEDAPSNLAVVGRYILTPRIFDKLVETQVGAGGEIQLTDGIAALL
AEEPVIAYPFKGKRYDCGSKLGYLEAQVELALQHPELGEDFAAYLKALAVE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggatccgcaaggcagtgtttcccgtggccgggcttggcacccgatttctgccg
gcaaccaaggcgagtcccaaggagatgttgccggtggtcgacaagccgctgatccagtat
gcggcggacgaggctgaagggggcggggcagagcagttggtgttcatcaccggccgcaac
aagcgctcgatcgaggaccatttcgataaggcctacgagctggagatggagctcgaaggg
gcgggcaagcagaagctcttggagatcgtccagaacctgctccccgcccacgtgagctgc
atctatcttcgccaggccgaggcgctcgggctcgggcatgcggtgctctgcgccaggcct
gtcgtcggtgacgagccgtttgccgtcatcctggccgacgacctgatccagggcgagggc
cagggtgtcatcgcgcagatggtcgaggtttacgagcgcttcgggtgcagcgtcctcggc
gtcgaggaggtgcctcgacaggagaccaacaagtacggcatcgtcgccaccgagaccgga
cctgacggcgagttgcgcgtcacctcgatggtcgagaagccggcaccggaggacgccccg
tcgaacctggccgtggtcggtcgttacatcctcaccccgcggatcttcgacaagttggtc
gagacgcaggtcggcgccggtggcgagatccagctcaccgatggtatcgcggcgctcctg
gccgaggaaccggtgatcgcctatccgttcaagggcaagcgctacgactgcggtagcaag
ctcggctacctggaggcgcaggtcgaactcgccctccagcacccggagcttggcgaggac
ttcgccgcctatctcaaggcactggcggttgaatga

DBGET integrated database retrieval system