KEGG   Thioflavicoccus mobilis: Thimo_1800Help
Entry
Thimo_1800        CDS       T02397                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00790  Folate biosynthesis
tmb01100  Metabolic pathways
Module
tmb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thimo_1800
Enzymes [BR:tmb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Thimo_1800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF DUF1088
Motif
Other DBs
NCBI-ProteinID: AGA90570
UniProt: L0GYW5
Position
complement(1992346..1992984)
Genome map
AA seq 212 aa AA seqDB search
MYDSSKAPRVSANGHYAESLDADSEDEVYDSHKESLVEALLCALGEDPGRDGLKRTPLRV
AKAMDFLTSGYQMSAEDVIKQALFEEDCTEMVVVRDIEFYSLCEHHMLPFFGHAHVGYLP
NGKVVGLSKIARVVDVFARRLQVQERLTNQVADALMTHLGAHGVAVVMEASHTCMMMRGV
QKQRSMTISSAMRGSFHEDPRTRAEFMSFIRS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacagcagcaaggcgccgcgggtctcggcaaacggtcactacgccgaaagcctc
gacgccgacagcgaagacgaggtctacgactcgcacaaggagtccctggtcgaggctctg
ctttgcgccttgggagaggatcctggccgggacggcctgaaacgcacgccgctgcgggta
gccaaggcgatggacttcctgacgagcggctatcagatgtcagccgaggatgtcatcaag
caggccctcttcgaagaggactgcaccgagatggtcgtggtccgcgatatcgaattctac
tcgctctgcgagcaccacatgctgcccttcttcggtcacgcccacgtgggttacctgccg
aacggcaaggtcgtcgggctcagcaagatcgcccgggtcgtcgacgtcttcgcccgccgc
ctccaagtccaggagcgactgaccaaccaggtcgccgatgccctgatgacccatctcggc
gcgcacggcgtcgccgtggtcatggaagccagccacacgtgcatgatgatgcgcggggtg
caaaaacagcgcagcatgacgatctcgagcgcaatgcgcggttccttccatgaagacccg
cgtacacgcgctgaattcatgtcgttcatccgctcctga

DBGET integrated database retrieval system