KEGG   Thioflavicoccus mobilis: Thimo_2072Help
Entry
Thimo_2072        CDS       T02397                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tmb  Thioflavicoccus mobilis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Thimo_2072
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Thimo_2072
Enzymes [BR:tmb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Thimo_2072
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2293957..2295042
Genome map
AA seq 361 aa AA seqDB search
MSLGPVMLDLDGPELSPEERELLGHPAVGGVILFSRNFVEPAQIAALTSAIHAVREPHLL
IGVDQEGGRVQRFREGFTRLPPVGRIGALFRDHPARGLRAAERLGWLMAAELRAVGVDFS
FAPVLDLDRGISHVIGDRAFGDSQTAVTELATAWMRGVHAAGMAAVGKHFPGHGGVAADS
HAELPRDERPLEALRHADLIPFERLIGHGLEAIMPAHVVYPRIDPQPAGFSSFWLRTLLR
RELDFQGIIFSDDLTMQGAAGVGDHRARADLALSAGCDMILVCNDRAAALETIDGRGPHE
DPTICLRLLRMHGRQALDNTALHQDPRREEALHSLAELDRYALPSLDLEDPTSHGKQNET
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgtccctaggtcccgtgatgctcgacctcgacggccccgagctgagcccggaggagcgc
gaactactcggccacccggccgtcggcggggtcatcctgttcagccgcaacttcgtcgag
ccggcccagatcgcagcgctcaccagcgcgatccacgcggtgcgcgagccgcacctgttg
atcggcgtcgaccaggaaggcggccgcgtgcagcggttccgcgagggcttcacgcggcta
ccgcccgtcgggcggatcggcgccctctttcgcgaccacccggcccgcggcctgcgcgca
gccgagcggctcggctggctgatggccgcggaactgcgcgccgtcggtgtcgacttcagc
ttcgcaccggtgctcgacctcgaccgcgggatcagccacgtcatcggcgaccgcgccttc
ggcgactcgcagactgccgtcaccgagctggccacggcctggatgcgcggtgtgcacgcg
gccggcatggcggccgtcggcaagcacttcccggggcacggcggtgtcgcagccgattcg
cacgccgagctgccgcgcgacgagcggccgctcgaggccctgcgccatgccgacctgatc
cccttcgagcgcctgatcggccacggcctcgaggccatcatgccggcccacgtcgtctac
ccgcggatcgatccgcagccggcgggtttttcctccttctggctccggaccctgctacgc
cgcgaactggacttccagggcataatcttcagcgacgacctgacgatgcagggggcggcc
ggcgtcggcgaccaccgggcccgcgccgatctggcgctctcggccggctgcgacatgatc
ctggtctgcaacgaccgcgccgcggcactcgagacaatcgacggccgtggtccccacgag
gatccgaccatctgcctgcggctgctgcggatgcatggccgccaggcgctcgacaacacg
gccctgcaccaagatccgcgccgggaggaggccctgcacagcctcgccgagctcgaccgc
tatgccctgccgtcactggacctcgaagacccgacaagccatgggaagcaaaatgaaact
gactga

DBGET integrated database retrieval system