KEGG   Thioflavicoccus mobilis: Thimo_2072Help
Entry
Thimo_2072        CDS       T02397                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tmb  Thioflavicoccus mobilis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tmb00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:tmb00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2293957..2295042
Genome map
AA seq 361 aa AA seqDB search
MSLGPVMLDLDGPELSPEERELLGHPAVGGVILFSRNFVEPAQIAALTSAIHAVREPHLL
IGVDQEGGRVQRFREGFTRLPPVGRIGALFRDHPARGLRAAERLGWLMAAELRAVGVDFS
FAPVLDLDRGISHVIGDRAFGDSQTAVTELATAWMRGVHAAGMAAVGKHFPGHGGVAADS
HAELPRDERPLEALRHADLIPFERLIGHGLEAIMPAHVVYPRIDPQPAGFSSFWLRTLLR
RELDFQGIIFSDDLTMQGAAGVGDHRARADLALSAGCDMILVCNDRAAALETIDGRGPHE
DPTICLRLLRMHGRQALDNTALHQDPRREEALHSLAELDRYALPSLDLEDPTSHGKQNET
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgtccctaggtcccgtgatgctcgacctcgacggccccgagctgagcccggaggagcgc
gaactactcggccacccggccgtcggcggggtcatcctgttcagccgcaacttcgtcgag
ccggcccagatcgcagcgctcaccagcgcgatccacgcggtgcgcgagccgcacctgttg
atcggcgtcgaccaggaaggcggccgcgtgcagcggttccgcgagggcttcacgcggcta
ccgcccgtcgggcggatcggcgccctctttcgcgaccacccggcccgcggcctgcgcgca
gccgagcggctcggctggctgatggccgcggaactgcgcgccgtcggtgtcgacttcagc
ttcgcaccggtgctcgacctcgaccgcgggatcagccacgtcatcggcgaccgcgccttc
ggcgactcgcagactgccgtcaccgagctggccacggcctggatgcgcggtgtgcacgcg
gccggcatggcggccgtcggcaagcacttcccggggcacggcggtgtcgcagccgattcg
cacgccgagctgccgcgcgacgagcggccgctcgaggccctgcgccatgccgacctgatc
cccttcgagcgcctgatcggccacggcctcgaggccatcatgccggcccacgtcgtctac
ccgcggatcgatccgcagccggcgggtttttcctccttctggctccggaccctgctacgc
cgcgaactggacttccagggcataatcttcagcgacgacctgacgatgcagggggcggcc
ggcgtcggcgaccaccgggcccgcgccgatctggcgctctcggccggctgcgacatgatc
ctggtctgcaacgaccgcgccgcggcactcgagacaatcgacggccgtggtccccacgag
gatccgaccatctgcctgcggctgctgcggatgcatggccgccaggcgctcgacaacacg
gccctgcaccaagatccgcgccgggaggaggccctgcacagcctcgccgagctcgaccgc
tatgccctgccgtcactggacctcgaagacccgacaagccatgggaagcaaaatgaaact
gactga

DBGET integrated database retrieval system