KEGG   Thioflavicoccus mobilis: Thimo_2212Help
Entry
Thimo_2212        CDS       T02397                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thimo_2212
Enzymes [BR:tmb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Thimo_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2453666..2455420)
Genome map
AA seq 584 aa AA seqDB search
MPSEAQPIKQTLPKGVMLNAYPDSIGGKLSDIVALLKRPEFDDVFSLFYILPTFFNSDLD
RGFSVIDYNHNEELVSLLDLEELRSLDIGFKFDLILNHLSVGSPQFQDLLQRGDESAYKD
FFIDWNEFWAGHGIMGPEGYVIPKQEFLQKLFMRKPGQPVLKVRFPDGTERPYWNTFYQK
ITYEPISPAHLMEIPGLTPEGAEILAEIVNAGIESKADVREIDLSEFAEHCEMVVEIVER
NREYLGQMDLNARSELVWEFYDETLKKLREYGAKIVRLDAFAYLHKAPGEVNFFNRPGTW
EYLERLKGIAEKHDLIIFPEIHSEYGCGLHEEVARKGFPIYDFFFPGLVIDALERGSRQH
LVAWVREIGEKGIQTINMLGCHDGIPVLDLRGKQLDAGLRPGLLPDQQIDEVMQRIVERG
GRIKNLFGPDGRKISYYQVNATFFSALGEDERKLRLARAIQMFMPGIPQVWYLDLFAGRN
NYAAADLGGPGGHKEINRTNLSLAELEEAIGSPIVQDQLKLMRLRNTSPAFAGTLEIGDG
PGHLLEMSWHNDGHRASLRADLREHSFTVRHTGNGGDEVVWEYR
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcgaagcacagccgatcaagcaaacactgccgaagggtgtgatgctcaatgcg
taccccgacagcatcggcggtaaactgtctgatatcgtggcactgctgaagaggccggaa
ttcgacgacgtattctcgctcttctatatcctgccgaccttcttcaatagcgatctcgat
cgtggtttctcggttatcgattacaaccacaacgaggagctggtttctttgctcgacctc
gaagaactgcgatcgctcgatatcggcttcaagttcgacctcatcctcaaccatctctcg
gttggttcgccacaatttcaggatctcctgcaacgtggtgacgaatccgcttacaaggac
ttcttcatcgattggaacgaattctgggcaggtcacggcatcatgggccccgaaggctac
gtgatcccgaagcaggaatttctgcagaagctctttatgcgcaagccgggacagccggta
ttgaaggtgcgtttccctgatgggaccgagcggccttattggaataccttctaccaaaag
atcacttacgagcccatctcgccggcgcatctgatggagatcccgggtctcacgcccgag
ggagccgagatcctggccgagatcgtcaatgccgggatcgaatcgaaggccgatgtgcgc
gagatcgatctcagcgagttcgccgagcattgcgagatggtcgtggagatcgtcgaacgc
aatcgtgaatatctcggacagatggatctcaatgccagatccgaactggtctgggagttc
tacgacgagaccttgaagaagctccgtgaatacggggcgaagatcgtacgactcgatgcc
ttcgcctatctgcacaaggcacccggcgaggtcaatttcttcaaccgtccaggcacctgg
gaatacctggagcggctcaaggggattgccgagaagcacgacctgatcatcttccccgag
atccactccgagtacggttgcggcctgcacgaggaggttgcccgcaagggtttcccgatc
tatgacttcttcttcccgggtctcgtcatcgatgccctggagcgggggtcgaggcagcac
cttgtcgcttgggtccgcgagatcggcgagaagggcatccagacgatcaacatgctcggc
tgtcacgatggcatcccggtcctcgacctccggggcaaacagctcgacgcgggcctgcgt
cccggcctgctgcccgaccaacagatcgacgaggtgatgcaacgcatcgtcgagcgcggc
gggcggatcaagaacctcttcggtccggacgggcgcaagatctcctactatcaggtgaat
gcgaccttctttagcgccctgggcgaggacgagcgcaagctgcgcctggcgcgggccatc
cagatgttcatgccgggtatcccgcaggtttggtacctggatctgtttgccggtaggaac
aactatgccgcggcggacctcggggggcctggcgggcataaggagatcaatcgcaccaac
ctctcgcttgccgagctcgaagaggcgatcggcagtccaattgtgcaggaccagctgaaa
ttgatgcggttgcgcaacacctcgccggccttcgccggcaccctcgagatcggcgacggt
ccgggccacctcttggagatgtcctggcacaacgacggtcatcgggcgagccttcgggcg
gacctgcgtgagcacagcttcaccgtcaggcacaccggcaatggcggcgacgaagtcgtc
tgggaataccgctga

DBGET integrated database retrieval system