KEGG   Thioflavicoccus mobilis: Thimo_2315Help
Entry
Thimo_2315        CDS       T02397                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tmb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2565827..2567722)
Genome map
AA seq 631 aa AA seqDB search
MSDDLRRLLETGRLAPLGYYFARFVARGSGVGEGSLLALSAALVSQRNLQGDVCVDLAEQ
VGRPLFENEIETEIGNDADGAESVAIPLGPALDSWLAELATSPWVGGPGAEAPLILDGHR
LYLGKYWHFEQQVAAALLARLEWVAELDRARLTEGLARLFDDAPAGEIDWQRVAAAVAVG
RRFAVISGGPGTGKTTTVVKVLALLLEQDPHQRIALAAPTGKAAARLTEAVRGRKGGLAL
DAAVLARIPEEASTIHRLLGFGRDGGPRYGRENPLPLDCLVVDEASMLDLPLTARLLAAL
PAHARLILLGDRDQLASVEAGNVLGDITGHGQEIRYGPAQVEALDALGAAPAGRLRQVSA
QDSAPRPVADAVGLLRVSHRFRAESGIGALAARVNAGAGEAAVALLDDPAHEDIDWLDAR
PDGLHPACIAWAAARYGRYLREPDVVAALRAFELARVLAAVHRGPFGVAELNRAIAARLQ
AQGLIAGGEEYHGKPVMVTTNDYEVGLFNGDIGLLWRDPDGALRAYFPLADGQVRRVSVR
QLPEHACAYALTVHKSQGSELDEVLLVLPYEPGPVVTRELIYTGITRARQRVTIQGHRAA
FLAGCRKRVRRASGLAERLGWGIDVVADGLA
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacctgcgccgcctgctggagaccggccggctcgcgccgctcggctactac
ttcgcccgcttcgtcgcccgcggcagcggtgtcggcgagggctcgctgctggcgctgagt
gcggccctcgtgagccagcgcaacctgcaaggggatgtctgcgtcgacctcgccgagcag
gtcggccggccgctgttcgaaaacgagatcgagaccgagatcgggaacgacgccgacggc
gcagagtcggtcgctatcccgctcggcccggcgctcgattcctggctcgccgagctcgcg
accagcccctgggtcggcggtccgggcgccgaggcaccgctgatcctcgacgggcatcgg
ctctatctcggcaagtactggcacttcgaacagcaggtcgccgcggccctgctggcgcgc
ctcgaatgggttgccgaactcgaccgtgcacgcctcaccgaggggctcgcgcggctcttc
gacgacgccccggcaggcgagatcgattggcagcgggttgccgccgccgtcgccgtcggg
cggcgcttcgccgtcatctcgggcgggccgggcaccggcaagacgacgaccgtcgtcaag
gtcctcgcgctgctgctggagcaggacccgcaccagcgcatcgcgctggccgcgccgacc
ggcaaggccgcggcgcgcctgaccgaggcggtgcgcgggcgcaagggcggcctggcgctc
gacgccgccgtcctcgcccgcatcccggaggaggcgagcacgatccaccggctgctcggg
ttcggccgcgacggcggcccgcgttacggccgagagaatccgctgccgctcgactgcctg
gtcgtcgacgaggcctcgatgctcgacctgccgctgaccgcccggctgctcgcggcactg
ccggcccatgcccgcctgatcctgctcggcgaccgcgaccaactcgcctcggtcgaggcc
ggcaacgtcctcggcgacatcaccggacacggccaagagatccgctacgggccggcgcag
gtcgaggccctcgatgcgctcggcgccgcgcccgccggtcggctgcgccaggtatccgcg
caggacagcgcgccgcgaccagtcgccgatgccgtcgggctgctgcgagtcagccaccgc
ttccgcgccgagagtggcatcggtgcgctcgcggcccgcgtcaacgccggggcaggggag
gcggcggtggcgctgctcgacgaccccgcccacgaggacatcgactggctcgatgcccgc
cccgacggcctgcacccggcctgcatcgcctgggcggccgcccgctacggccgctacctg
cgcgagcccgacgtcgtcgcggcgctgcgcgccttcgagttggcgcgggtcctcgccgcc
gtgcaccgcgggccattcggcgtcgccgagctcaaccgggcgatcgctgcgcgcctccag
gcccagggcctcatcgccggcggtgaggaataccacggcaagcccgtcatggtgacgacc
aacgactacgaggtcggcctcttcaacggcgacatcggcctcctctggcgcgaccccgac
ggcgcgctgcgcgcctacttcccactcgccgacggccaggtccggcgcgtctcggtccgc
caactccccgagcacgcctgcgcctatgcgctcaccgtccacaagagccagggctccgag
ctcgacgaggtcctcctcgtcctgccctacgaaccgggcccggtcgtcacccgcgagctc
atctacaccggcatcacccgtgcccggcagcgcgtcaccatccaggggcatcgggcggcg
tttcttgccggttgtcggaaaagggtgcgaagggcgtcggggttggcggagaggttgggg
tgggggattgatgttgtcgccgatggactggcatag

DBGET integrated database retrieval system