KEGG   Thioflavicoccus mobilis: Thimo_2319Help
Entry
Thimo_2319        CDS       T02397                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Thimo_2319
   00240 Pyrimidine metabolism
    Thimo_2319
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Thimo_2319
   03430 Mismatch repair
    Thimo_2319
   03440 Homologous recombination
    Thimo_2319
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Thimo_2319
DNA replication proteins [BR:tmb03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Thimo_2319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2575278..2575718)
Genome map
AA seq 146 aa AA seqDB search
MAETRVSFYSLAEDAPGDRFQLACRLVERIYAAGLRVYILAASDQEARHLDRLLWTFREQ
SFIPHGLKGETDADLTPILIGWDADPGDARAVLINLSGRVPERLERFERLCEAVDQDPAI
RDAARERFRHYRRAGLSLEHHQIRLS
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacgcgggtcagcttctacagcctcgccgaggacgccccgggagaccgtttc
cagcttgcctgccggctcgtcgagcggatctacgcggcggggctgcgcgtctacatcctg
gcggcgtccgatcaggaggcgcggcacctggatcgactgctctggacgttccgcgagcag
agcttcattccgcacggcctcaagggcgagacggacgccgatctgacgccgatcctgatc
ggctgggatgccgatcccggcgacgcgcgggctgtcctgatcaacctctcgggccgagtg
cccgagcggctcgagcgcttcgagcggctctgcgaggccgtggaccaagacccggcgatc
cgggatgcggcccgcgagcgcttccggcactatcggcgtgccggtttatcgctcgaacac
caccaaatcaggctatcttga

DBGET integrated database retrieval system