KEGG   Thioflavicoccus mobilis: Thimo_2556Help
Entry
Thimo_2556        CDS       T02397                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Thimo_2556
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thimo_2556
Enzymes [BR:tmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Thimo_2556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2827437..2828423
Genome map
AA seq 328 aa AA seqDB search
MRRDDLQRDADGGLKHFLTIDGLDRPLLTEILDRAEGFLGVSEQAVKKVPLCRGKIIANL
FFENSTRTRTTFELAAKRLSADVLNLNIGTSSTSKGETLLDTLRNLEAMHVDMFVVRHNV
SGAAHFFAQHAAPHISVINAGDGSHSHPTQAMLDMFTIRRHKGDFGQLTVAIVGDILHSR
VARSQIHALRGLGTGEVRVIGPRTLIPAPVEDLDVRIFHDLREGVRDADVVIMLRLQRER
MTGALLPSEREYFHLYGLTEAQLETAKPDAIVMHPGPINRGVEMDSQVADGPRSVILEQV
SNGIAVRMAIMSMCIGSQNRRSQGEGDG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagacgacctgcaacgcgatgccgacggcggcctgaagcactttctgacgatc
gatggtctggaccgcccgctgctgaccgagatcctcgatcgtgccgagggcttcctcggg
gtctccgagcaggcggtcaagaaggtgcctctgtgccgcggcaagatcatcgccaacctg
ttcttcgaaaacagcacgcgcacgcgcacgaccttcgaactcgccgccaagcgcctctcg
gccgacgtactcaacctcaatatcggcacctcctcgacctcgaagggcgagaccctgctc
gatacgctgcgcaacttggaggcgatgcatgtcgacatgttcgtcgtgcgccacaacgtg
agcggcgccgcgcacttcttcgcccagcatgccgcgccgcacatcagcgtcatcaacgcc
ggcgacgggagccactcgcacccgacccaggccatgctggacatgttcacgatccgccgc
cacaagggcgacttcggtcagctgaccgtcgccatcgtcggagacatcctgcattcgcgc
gtggcccgctcgcagatccacgcgctgcgcgggctcggcaccggcgaggtgcgggtgatc
gggccgcgtaccctgatcccggcgccggtcgaggacctcgacgtgcgcatcttccacgac
ctgcgcgagggcgtgcgcgacgccgacgtcgtcatcatgctgcgcctgcaacgcgagcgg
atgaccggcgccctgctgccgagcgagcgtgaatacttccacctctacggcctcaccgag
gcgcagctcgagaccgccaagccggacgccatcgtgatgcaccccggaccgatcaaccgc
ggcgtcgagatggactcccaggtcgccgacggcccgcgctcggtgatcctggagcaggtc
agcaacggcatcgcggtgcgcatggcgatcatgtccatgtgcatcggcagccagaaccgg
cgcagccagggagagggcgatggctga

DBGET integrated database retrieval system