KEGG   Thioflavicoccus mobilis: Thimo_2556Help
Entry
Thimo_2556        CDS       T02397                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tmb00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tmb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2827437..2828423
Genome map
AA seq 328 aa AA seqDB search
MRRDDLQRDADGGLKHFLTIDGLDRPLLTEILDRAEGFLGVSEQAVKKVPLCRGKIIANL
FFENSTRTRTTFELAAKRLSADVLNLNIGTSSTSKGETLLDTLRNLEAMHVDMFVVRHNV
SGAAHFFAQHAAPHISVINAGDGSHSHPTQAMLDMFTIRRHKGDFGQLTVAIVGDILHSR
VARSQIHALRGLGTGEVRVIGPRTLIPAPVEDLDVRIFHDLREGVRDADVVIMLRLQRER
MTGALLPSEREYFHLYGLTEAQLETAKPDAIVMHPGPINRGVEMDSQVADGPRSVILEQV
SNGIAVRMAIMSMCIGSQNRRSQGEGDG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaggagagacgacctgcaacgcgatgccgacggcggcctgaagcactttctgacgatc
gatggtctggaccgcccgctgctgaccgagatcctcgatcgtgccgagggcttcctcggg
gtctccgagcaggcggtcaagaaggtgcctctgtgccgcggcaagatcatcgccaacctg
ttcttcgaaaacagcacgcgcacgcgcacgaccttcgaactcgccgccaagcgcctctcg
gccgacgtactcaacctcaatatcggcacctcctcgacctcgaagggcgagaccctgctc
gatacgctgcgcaacttggaggcgatgcatgtcgacatgttcgtcgtgcgccacaacgtg
agcggcgccgcgcacttcttcgcccagcatgccgcgccgcacatcagcgtcatcaacgcc
ggcgacgggagccactcgcacccgacccaggccatgctggacatgttcacgatccgccgc
cacaagggcgacttcggtcagctgaccgtcgccatcgtcggagacatcctgcattcgcgc
gtggcccgctcgcagatccacgcgctgcgcgggctcggcaccggcgaggtgcgggtgatc
gggccgcgtaccctgatcccggcgccggtcgaggacctcgacgtgcgcatcttccacgac
ctgcgcgagggcgtgcgcgacgccgacgtcgtcatcatgctgcgcctgcaacgcgagcgg
atgaccggcgccctgctgccgagcgagcgtgaatacttccacctctacggcctcaccgag
gcgcagctcgagaccgccaagccggacgccatcgtgatgcaccccggaccgatcaaccgc
ggcgtcgagatggactcccaggtcgccgacggcccgcgctcggtgatcctggagcaggtc
agcaacggcatcgcggtgcgcatggcgatcatgtccatgtgcatcggcagccagaaccgg
cgcagccagggagagggcgatggctga

DBGET integrated database retrieval system