KEGG   Thioflavicoccus mobilis: Thimo_2772Help
Entry
Thimo_2772        CDS       T02397                                 

Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thimo_2772
Enzymes [BR:tmb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Thimo_2772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3055110..3058859
Genome map
AA seq 1249 aa AA seqDB search
MKPRPISHAEATPVRVVIVTLDSHLASAVARARAALSKELPGLELSLHAAAEWSEDGAAL
ERARAAIGEADIIVATMLFMEEHIAAVLPALAARAEQCDALVGCLSAGEVIRLTRLGRFR
LDGSERGPLALLKRLRGAKKGQEGGSAGAQQMALLRRLPQILRFIPGTAQDVRAYFLALQ
YWLAGSDENVANLVRLLVDRYADGPRRALRGRLKVAAPTEYPEVGLYHPRMKGRISERAE
RLPGARGASGEAGTVGLLVMRSYVLAGNAAHYDGVIAALEARGLRVIPAFASGLDARPAV
AKYFRRDGRTLVDAVVSLTGFSLVGGPAYNDARAAEATLAELDVPYLAAQPLEFQTLEQW
EGSEQGLLPVEATMMVAIPELDGAGGPMVFGGRSAQAAASQQRDMRAHPERVSQLAARVA
RWVALRRTPPAERRVAIVLFNFPPNAGSVGTAAHLAVFESLYNTLAMLAEAGYRVEVPAD
VDALRARLLEGNAARYGTQANVHAHVPVDTHVRREPHLKAIEAQWGPAPGREQSDGRGLF
ILGADFGEVFVGIQPAFGYEGDPMRLLFEKGFTPTHAFSAFYHYLREDLKAHAVVHFGTH
GALEFMPGKQAGLSGDCWPDRLIGDLPNLYLYAANNPSEGTIAKRRAAATLISYLTPPLA
QAGLYRGLLDLKASIERWRTLPPEEAGERADLAGLIQAQAAELELAEPEPAWPGEAAEGE
VLRLWQAVLELEDTLIPHGLHVVGAVPSAAERADLLAALAEASHGLHVPAAALEALVAER
PLEEILAAAAQDPEQAQAEQDQAAIYGELLRIARLLGVDHELAAIRHALDGRFVRPVPGG
DLLRTPAILPTGRNLHGFDPFRLPSVFALKDGARQAERLIARHIDSGAGLPETIALVLWG
TDNLKSEGGPIAQALALIGARPRFDSYGRLAGAELIPLDELKRPRIDVVMTLSGIFRDLL
PLQTKLLAEATYLAASAADEPLEANFVRRHALDYQAAHGGDLETAALRVFSNADGAYGSN
VNHLIDNSRWSDEDELAETYTQRKCFAYGRSGRPVRQAELLNSVLANVQLAYQNLDSVEL
GVTTIDHYFDTLGGISRAVGRAKGAEVPVYIGDQTRGDGQVRTLAEQVALETRTRMLNPK
WYEGMLKHGYEGVRQIEAHITNTMGWSATTGQVAPWVYEQLTQTYVLDEEMRERLAALNP
TASVKVAHRLLEAHERRYWEPDAATLEALRRAGEELEDRLEGVVEEAAA
NT seq 3750 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaaggcccatttcgcacgctgaggcgacgccggtgcgcgtcgtcatcgtcacg
ctggacagtcatttggcaagcgccgtggcgcgcgcccgcgcggcgctgtcgaaggagctg
ccggggctggagctgagcctgcacgcggcggcggagtggagcgaggacggtgcggcgctg
gagcgtgcccgcgcggcgatcggcgaggccgacatcatcgtggcgacgatgctgttcatg
gaggagcacatcgcggcggtgctgccggcgctggcggcgcgcgccgagcagtgcgatgcg
ctggtcgggtgtctctccgccggtgaggtgattcgcttgacgcgcctggggcggtttcgc
ctcgacggcagcgagcgcggcccgctggcgttgctcaagcgcctgcgcggggcgaagaag
ggccaagaaggcggcagcgccggggcccagcagatggcgctactgcgccgcctgccgcag
atcctgcgcttcattcccggcacggcgcaggacgtgcgcgcctacttcctggccctgcaa
tactggctggcgggctccgatgagaatgtcgccaacctggtgcgcctgctcgtcgaccgc
tatgccgacggcccgcggcgcgccttgcgcgggcggctcaaggtcgcggccccgaccgag
tatcccgaggtcgggctctaccacccgcgcatgaaggggcgcatcagcgagcgggccgag
cgtctgcccggggcccgcggggcgagcggggaggccggtacggtggggctgttggtgatg
cgctcctacgtcctggctggcaacgccgcccattacgacggggtcatcgcggcgctcgag
gcccgcggcctacgcgtcattccggccttcgccagcggcctcgacgcccgcccggcggtg
gccaagtacttccgccgcgacgggcgcaccctggtcgatgcggtggtctcgctgaccggc
ttctcgctggtcgggggcccggcctacaacgatgcgcgcgccgccgaggcgacgctcgcc
gagctcgacgtgccctatctcgccgcccagccgctggagttccagaccctggagcaatgg
gaaggctccgagcagggcctcctgccggtcgaggcgaccatgatggtggccatccccgag
ctcgacggggcgggcggcccgatggtcttcggcgggcgctcggcgcaggccgccgcctct
cagcagcgcgacatgcgcgcccaccccgagcgggtcagccagctggccgcgcgtgtggcg
cgctgggtcgcgctgcggcgcaccccccccgccgagcggcgcgtggccatcgtgctgttc
aacttcccgcccaatgccggcagcgtcggcaccgccgcccacctggcggtcttcgaatcc
ctctacaacacactcgccatgctcgccgaggccggctatcgcgtcgaggtccccgccgat
gtcgatgccctgcgcgcgcgcctcctggaaggcaacgcggcgcgctacggcacccaggcg
aacgtgcacgcccacgtgccggtcgacacccacgtgcggcgcgagccgcacttgaaagcg
atcgaggcccagtggggcccggcccccgggcgcgagcagagcgacgggcgcgggctcttc
atcctcggcgccgacttcggcgaggtcttcgtcggcatccagccggccttcggctacgaa
ggcgacccgatgcgcctgctcttcgagaagggcttcacccccacccacgccttcagcgcc
ttctaccactacctgcgcgaagacctcaaggcccacgcggtggtgcacttcggcacccac
ggggcgctcgaattcatgcccggcaagcaggccgggctctcgggcgactgctggccggac
cgcctgatcggcgacctgcccaacctctacctctacgccgccaacaacccctccgagggg
accatcgccaagcgccgcgcggcggccaccctgatcagctacctgaccccgccgctggcg
caggccgggctctaccggggactgttggatctgaaggcctcgatcgagcgctggcgcacc
ctgccgcccgaggaggccggcgagcgcgccgacctggccgggctgatccaggcccaggcc
gccgagctcgaactcgccgagcccgagcccgcctggccgggcgaggccgccgaaggcgag
gtcctccggctctggcaggcggtactcgagctcgaagacaccctcatcccgcacggcctg
cacgtggtcggcgccgtgccgagcgccgccgagcgggccgacctgctcgcggccctggcc
gaggcgagccacggcctgcacgtgccggcggcggcgctcgaggcgctggtcgccgagcgc
ccgctcgaggagatcctcgccgcggccgcccaggatccggagcaggcgcaagccgagcag
gaccaggcggcgatctacggcgagctcctcaggatcgcccgcctgctcggcgtcgatcac
gagctcgccgccatccgtcacgccctcgatggacgcttcgtgcgcccggtgccgggcggc
gacctgctgcgtaccccggcgatcctgcccaccgggcgcaacctgcacggcttcgacccc
ttccgcctgccgagcgtcttcgccctcaaggacggggcgcgccaggccgagcggctcatc
gcgcgccacatcgactccggggccggactgcccgagaccatcgccctggtgttgtggggc
accgataacttgaagagcgagggcggcccgatcgcccaggccctggcgctgatcggggcg
cgcccgcgcttcgacagctacgggcgcctggcgggggccgagctgatcccgctcgatgag
ctcaagcgcccgcgcatcgatgtcgtcatgaccctctcggggatcttccgcgacctgttg
ccgctgcagaccaagctcctggccgaggccacctatctggccgccagcgccgccgacgag
ccgctggaggccaacttcgtgcgccgccacgcgctcgactaccaggccgcccacggtggg
gatctggagaccgcggcgctgcgggtgttcagcaacgccgacggcgcctacggctccaac
gtcaatcacctcatcgacaacagtcgctggagcgacgaggacgagctggccgaaacctac
acccagcgcaagtgcttcgcctacgggcgcagcgggcgcccggtgcgccaggccgagctg
ttgaacagcgtgctcgccaatgtccagctcgcctaccagaacctcgactccgtcgagctc
ggcgtgaccaccatcgaccactacttcgacaccttgggcggcatcagccgcgcggtgggg
cgtgccaagggcgccgaggtaccggtctacatcggcgatcagacccgtggcgacggacag
gtgcgtacgctcgccgagcaggtggcgctggagacgcgcacacgcatgctcaatcccaag
tggtacgagggcatgctcaagcacggctacgagggggtgcgccagatcgaggcgcacatc
accaacaccatgggctggtcggccaccaccggacaggtcgccccgtgggtctacgagcag
ctcacccagacctacgtcctcgatgaggagatgcgcgagcgcctcgcggcgctgaacccg
accgcctcggtgaaggtcgcccatcgcctcctggaggcccacgaacggcgctattgggag
cccgatgccgccacgctggaggccctgcgccgcgccggcgaggagctcgaggatcgcctc
gagggcgtcgtcgaggaggccgccgcgtga

DBGET integrated database retrieval system