KEGG   Thioflavicoccus mobilis: Thimo_2935Help
Entry
Thimo_2935        CDS       T02397                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tmb  Thioflavicoccus mobilis
Brite
Enzymes [BR:tmb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Thimo_2935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3221377..3222165
Genome map
AA seq 262 aa AA seqDB search
MLSILMRNGFGTLAATYRGPVLLSADQTDGGPGLGRSEPDESAERDALIREIERGVFETQ
FALGTDHLDPAVLAAVRAVPRHAFVPSELRQQAYRDHPLPIGGGQTISQPYIVAIMSHLL
GVGPGDRVFELGTGSGYQAAVLAEMGVEVYTVEIVPEHAERSARLLAELGYERVQVRVDD
GYLGWPEAAPFAGIIATAAADHIPRPLIDQLAAGGRLVMPVGGDGRIQQLTLIEKLPDGD
LHQRTILPVRFVPVTGEYVHSE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcgatcctgatgcgcaatggtttcggtacgctggcggcaacctaccgcggaccc
gtgctgctcagcgccgaccagaccgacggcggccccggcctcgggcgcagcgaaccggac
gaaagcgccgaacgggacgctctgatccgcgagatcgagcgcggcgtcttcgagacccaa
ttcgcgctcggcacggaccacctcgacccggccgtgctggcggcggtgcgcgccgtgccg
cgccacgccttcgtgccgtccgagctgcgccagcaagcctatcgcgaccacccgctgccg
atcggcggcggtcagaccatctcccagccctacatcgtcgccatcatgagccacctgctc
ggcgtcggccccggggaccgcgtcttcgaactgggcacaggctcgggctatcaggccgcc
gtgctggccgagatgggcgtcgaggtctacaccgtcgagatcgtgcccgaacatgccgaa
cgctcggccaggctcctcgctgaactcggctacgagcgggtccaggttcgcgtcgacgac
ggctacctcggctggcccgaggccgcacccttcgccggcatcatcgccaccgccgccgcc
gatcacatcccccgcccgctcatcgatcaactggccgcgggcgggcgcctggtcatgccc
gtcggcggcgacgggcgcatccagcagttgaccctgatcgaaaagctgccagacggcgac
ctgcaccagcgcaccatcctgcccgtgcgcttcgtgccggtcaccggcgagtacgtgcac
tcagaatga

DBGET integrated database retrieval system