KEGG   Thioflavicoccus mobilis: Thimo_3014Help
Entry
Thimo_3014        CDS       T02397                                 

Definition
magnesium chelatase ATPase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thimo_3014
Enzymes [BR:tmb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Thimo_3014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3295700..3297490)
Genome map
AA seq 596 aa AA seqDB search
MSDGAPEVSRWDDATLAAALLAIDPIGIGGVALRALAGPVRERWLELVRELLPEGMPLRR
VPLHVTDGRLLGGLDLAATLRSGRPVAERGLLVESDGGVVVLAMAERVSPTTAARLTAAL
DMGEVVLERDGLALRTPARFGVIALDEGVADDERLPTALLDRLAIPLDLTEIAAREAIGS
LYDADDVAAARERLAHVEASDQAIESLCGASLTLGIGSLRASLQGLRVARVAAALAGRDQ
VTDADLAVAGRLVLAPRATVLPMTEPPPDQESPEPPPPPEDEPPSNEDQAEQESTIDEET
LTDLILEAAKAAMPEHLLAQLAMAGRSRGRSRSSGKAGMVQQGSLRGRPAGVRRGEPRAG
ARMNVVETLRSAAPWQRVRRAESRAQPQSQGRPRVEVRAEDFRITRYKQRSETTTIFAVD
ASGSSALHRLAEAKGAVELLLADCYVRRDRVALIAFRGREAELLLPPTRSLVRAKRSLAG
LPGGGGTPLAAGLDAAVALADGVRRRGGTPVLVLLTDGRANIARDGTGGRARAEEEAMVS
ARLVRAAELTALLVDTSPRPQDKAAQLAGEMGATYLPLPYADAGVVSRAVQAAGQG
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacggagctccggaggtctcgcgctgggacgacgcgaccctggcggcggccctg
ctcgcgatcgatcccatcggtatcggcggtgtggcgctgcgggccctggcgggaccggtg
cgcgagcgctggctcgagctcgtgcgcgagctcctgcccgaggggatgccgctgcggcgc
gtcccgttgcatgtcacggacgggcgcttgctcggcggtttggacttggccgcgacgctg
cgctcgggtcgccccgtcgccgaacgtggcctgttggtcgagtccgatggcggcgtcgtg
gtcctcgccatggccgagcgcgtctcgccgacgacggcggcccgcctaaccgcggcgctc
gatatgggcgaggtcgtgcttgaacgcgacggactcgcgctgcgcacgccggcgcgcttc
ggcgtgatcgccctcgacgaaggggtcgccgatgacgagcgcctgcccacggcgctcctc
gatcgtttggccattccattggatctcaccgagatcgccgcgcgcgaggcgatcggctcg
ctctacgacgccgacgatgtggccgcggcgcgtgaacgcctcgcccatgtcgaggcgagc
gaccaggcgatcgagtcgctctgcggcgcctcgctcactttgggtatcggctcgctgcgc
gcctcgctccaggggttgcgtgtggcccgggtcgcggcggcgctggccggtcgcgaccag
gtcacggacgccgacctcgccgtcgccgggcgtctcgttttagccccccgtgcgacggtg
ttgccgatgaccgagccgccgcccgatcaggaatcgcccgagccgcccccaccgcccgag
gacgaaccgccgtccaacgaggatcaggcggagcaggaatcgacgatcgatgaggagacc
ctgaccgatctcatcctcgaggcggccaaggcggcgatgccggagcacttgttggcccag
cttgcgatggccgggcgcagccgcgggcggtcgcgttcgagcggcaaggcgggcatggtc
cagcagggctcgctacgcggtcggccggccggggtacggcgcggcgagccgcgtgccggg
gcgcggatgaacgtcgtcgagacattgcgttccgcggccccctggcagcgtgtgcggcgc
gccgagtcgcgggcccagccacagtcgcaggggcggccacgcgtcgaggtgcgcgccgag
gactttcggatcacgcgttacaagcagcgttcggagacgacgaccatctttgccgtcgat
gcatccgggtcttcggcgctgcaccgtctggccgaggccaagggcgccgtcgagctgctc
ctggccgactgctacgtgcgccgcgaccgcgtcgcgctgatcgccttccggggtcgagag
gctgagctcttgctgccgccgacccgctcgttggtgcgtgccaagcgcagcctggcgggt
ctaccgggcggcggtggcacgccgctcgccgccggtctcgatgccgcggtcgccctggcc
gacggcgtgcgccggcgcggcggcacgccggtcctggtcctgttgacggacgggcgggcc
aacatcgcgcgcgacggtaccggtgggcgggcgcgggccgaggaggaggcgatggtctcg
gcgcgtttggtgcgcgccgccgagctgacggccctgttggtcgatacctcgccgcgtccg
caggacaaggcggcgcaactggccggcgagatgggtgcgacctatctgccgctgccctac
gctgatgccggcgtcgtctcccgtgcggtccaggcggcggggcagggctag

DBGET integrated database retrieval system