KEGG   Thioflavicoccus mobilis: Thimo_3015Help
Entry
Thimo_3015        CDS       T02397                                 

Definition
magnesium chelatase ATPase subunit I
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tmb00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3297487..3298518)
Genome map
AA seq 343 aa AA seqDB search
MSVVFPFSAIVGQDEMKMSILIAAVDPSVGGVLVFGDRGTGKSTAIRALAALLPKMRAVV
SCTYNCDPEAPDGGLCSSCRETRASNQTLKSKLMSVPVVDLPLGATEDRVIGALDLESAL
TRGEKAFEPGLLARAHRGFLYIDEANLLEDHLVDALLDVAASGENVVEREGLSVRHPARF
VLVGSGNPEEGELRPQLLDRFGLSVEVKTPEDLATRITVVRRRDEFERDPAAFVAKWKRK
DGKIRRQIESAKANLRDITVPDETLERAAQLCMALGTDGLRGELTLIRAARALAALGGDD
SVGDSHLTRVAAPALRHRLRRNPLDDAGSTTRVERAVEELFGA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgtatttccattttcggcgatcgtcggtcaggacgagatgaagatgtcgatc
ctgatcgcggcggtcgatccttccgtcggtggcgtcttggtcttcggtgatcgcggcacc
ggcaaatccacggcgatccgcgcgttggccgcactgctgccgaagatgcgtgccgtcgtc
agctgcacctacaactgcgaccccgaagcaccggacggtggtctctgtagcagctgtcgc
gagacgcgtgccagcaaccagacgctgaagagcaagctgatgtcggtgccggtggtcgac
ctgcccctcggcgcgaccgaggaccgcgtcatcggtgcgctcgacctcgagagcgccctg
acgcgcggcgaaaaggccttcgagcccggcttgctggcgcgtgcccaccgtggtttcctg
tacatcgacgaggccaatctcctcgaggatcacctggttgacgcgctgctcgacgtggcg
gcctcgggcgagaacgtcgtcgagcgcgagggcctcagcgtacgccacccggcccgtttc
gtccttgtcggcagcggcaatccggaggagggcgagttgcgtccgcaattgctcgaccgc
ttcggactgtcggtcgaggtcaagaccccggaggatctcgcgacgcgcatcacggttgtg
cgccggcgcgacgagttcgagcgtgatccggcggcattcgtcgccaaatggaagcgcaag
gacggcaagatccgccgtcagatcgaatcggccaaggccaatctgcgcgacattaccgtc
ccggacgagacgctggagcgtgccgcgcagctgtgcatggcgctcggcaccgacggcctg
cgcggcgagttgacgctgatccgcgccgcccgcgccttggcggccctcggcggtgacgac
tcggtcggcgactcccacctcacgcgtgtcgccgcaccggcgctacgccaccggctgcgc
cgcaatccgctcgatgacgccggctcgacgacgcgagtcgagcgggcggtggaggagctc
ttcggggcatga

DBGET integrated database retrieval system