KEGG   Thioflavicoccus mobilis: Thimo_3015Help
Entry
Thimo_3015        CDS       T02397                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00860  Porphyrin and chlorophyll metabolism
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thimo_3015
Enzymes [BR:tmb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Thimo_3015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 AAA_16 MCM Sigma54_activat AAA_29 AAA DUF815 AAA_30 AAA_18 TsaE FtsK_SpoIIIE Mg_chelatase_C AAA_23
Motif
Other DBs
NCBI-ProteinID: AGA91706
UniProt: L0H0F3
Position
complement(3297487..3298518)
Genome map
AA seq 343 aa AA seqDB search
MSVVFPFSAIVGQDEMKMSILIAAVDPSVGGVLVFGDRGTGKSTAIRALAALLPKMRAVV
SCTYNCDPEAPDGGLCSSCRETRASNQTLKSKLMSVPVVDLPLGATEDRVIGALDLESAL
TRGEKAFEPGLLARAHRGFLYIDEANLLEDHLVDALLDVAASGENVVEREGLSVRHPARF
VLVGSGNPEEGELRPQLLDRFGLSVEVKTPEDLATRITVVRRRDEFERDPAAFVAKWKRK
DGKIRRQIESAKANLRDITVPDETLERAAQLCMALGTDGLRGELTLIRAARALAALGGDD
SVGDSHLTRVAAPALRHRLRRNPLDDAGSTTRVERAVEELFGA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcgtatttccattttcggcgatcgtcggtcaggacgagatgaagatgtcgatc
ctgatcgcggcggtcgatccttccgtcggtggcgtcttggtcttcggtgatcgcggcacc
ggcaaatccacggcgatccgcgcgttggccgcactgctgccgaagatgcgtgccgtcgtc
agctgcacctacaactgcgaccccgaagcaccggacggtggtctctgtagcagctgtcgc
gagacgcgtgccagcaaccagacgctgaagagcaagctgatgtcggtgccggtggtcgac
ctgcccctcggcgcgaccgaggaccgcgtcatcggtgcgctcgacctcgagagcgccctg
acgcgcggcgaaaaggccttcgagcccggcttgctggcgcgtgcccaccgtggtttcctg
tacatcgacgaggccaatctcctcgaggatcacctggttgacgcgctgctcgacgtggcg
gcctcgggcgagaacgtcgtcgagcgcgagggcctcagcgtacgccacccggcccgtttc
gtccttgtcggcagcggcaatccggaggagggcgagttgcgtccgcaattgctcgaccgc
ttcggactgtcggtcgaggtcaagaccccggaggatctcgcgacgcgcatcacggttgtg
cgccggcgcgacgagttcgagcgtgatccggcggcattcgtcgccaaatggaagcgcaag
gacggcaagatccgccgtcagatcgaatcggccaaggccaatctgcgcgacattaccgtc
ccggacgagacgctggagcgtgccgcgcagctgtgcatggcgctcggcaccgacggcctg
cgcggcgagttgacgctgatccgcgccgcccgcgccttggcggccctcggcggtgacgac
tcggtcggcgactcccacctcacgcgtgtcgccgcaccggcgctacgccaccggctgcgc
cgcaatccgctcgatgacgccggctcgacgacgcgagtcgagcgggcggtggaggagctc
ttcggggcatga

DBGET integrated database retrieval system