KEGG   Thioflavicoccus mobilis: Thimo_3133Help
Entry
Thimo_3133        CDS       T02397                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tmb  Thioflavicoccus mobilis
Pathway
tmb00900  Terpenoid backbone biosynthesis
tmb01100  Metabolic pathways
tmb01110  Biosynthesis of secondary metabolites
tmb01130  Biosynthesis of antibiotics
Module
tmb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Thimo_3133
Enzymes [BR:tmb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Thimo_3133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AGA91816
UniProt: L0H0S1
Position
3433509..3434363
Genome map
AA seq 284 aa AA seqDB search
MRDIDAWQQPWPAPAKLNLMLRVLGRRPDGYHRLQTVFQFVDHCDLITFAPHADGLIERT
NELPGVAPEQDLVVRAAQLLRATSGCRHGATIDVDKRLPMGGGLGGGSSDAATTLVALDH
LWDTRLGTETLAELGLQLGADVPVFVRGLAAWGEGVGEELEPIELPEPWYLVLKPPCEVS
TAAIFGDEDLTRNSPPITIRDFLSGEAGNDCLTVVTRRHPEVAAAMEWLRGWGEAKLTGT
GACIFAAFATQGQAEAAHAAAPPQYSAFVAPGRNRSPLLERLNG
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgagagatatcgacgcctggcaacagccttggccggccccggccaagctcaatctgatg
ctgcgggtgctcggccggcgaccggatggctatcaccgtctccagacggtcttccagttc
gtcgatcactgcgatctcatcaccttcgcgccgcacgccgacgggctcatcgagcgcacc
aacgagttgccgggcgtcgcccccgaacaggatctggtcgtgcgcgccgcgcagttgtta
cgggccacctcgggctgccgtcacggcgccacgatcgacgtcgacaagcgtctacccatg
ggcggcggtctcggcggcggcagctcagatgccgccacgaccctggtcgccctcgaccac
ctatgggacacccgcctcggcaccgagaccctcgccgaactcggcctccagctcggcgcc
gatgtcccggtgttcgtgcgcggcctggccgcttggggcgagggggtcggcgaggaactg
gagccgatcgagttgccggagccctggtacctggtcctcaagccgccgtgcgaagtctcc
acggcggccatcttcggtgacgaggacttgacaaggaactcgccgccgatcacgatacgc
gactttctctccggcgaggcgggaaacgattgcctgacggtcgtcactcgtcgccacccg
gaggtcgccgccgcgatggagtggctgcgtggctggggtgaggccaaactcaccggtaca
ggcgcctgcatcttcgctgcctttgcaacgcaggggcaagccgaagccgcgcacgccgcc
gcgccgccgcaatactcggccttcgtcgcgcccggcaggaaccgctccccgctgttggag
cgattgaacggttga

DBGET integrated database retrieval system