KEGG   Thioflavicoccus mobilis: Thimo_3317Help
Entry
Thimo_3317        CDS       T02397                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thimo_3317
Enzymes [BR:tmb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Thimo_3317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3631653..3633149)
Genome map
AA seq 498 aa AA seqDB search
MLIEDTPPSASQDQRRAGALLHLTSLPGPGPCGDLGMPARNYVDFLADCGISVWQMLPVG
PTQRELSPYQTSSAHAGSWRLIALEPLVEQGWLQAEELAALQGSDEGKARALSLAYGRFQ
EAGDTSDRQGLERFVAEHSYWLEDWSLFWALRQEIGQCWWHWPDALRHRDPQDLAAARAR
LSAEIDFIVFEQYLFFSQWQTLRAYAEARGIRLFGDMPIFVAHDSAEVWARPQDFDLNPD
GTTRVVAGVPPDYFSATGQRWGNPLYRWQEMVNDGFRFWIDRIRTQLRLFHMVRIDHFRG
FEAYWEIPAGETYAIHGRWVKAPGAALFSRLNQYFGQIPLIAEDLGLITEEVEALRKRFR
LPGMKVLQFAFSGGAANPYLPFHHDRDSVVYTGTHDNDTTLGWYESLSDAERAYVGEYLG
RPAEPMPWPLVRCAFASRAHLAVVPMQDILGLDSAHRMNTPGTVDAKNWQWRFDWSSVPS
DLPARMRRLVAIYGRLVS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcttatcgaagacacacccccttccgctagccaagaccagcgtcgcgccggcgccttg
ctgcacctgacctccctgccggggccgggcccctgcggcgacctcgggatgccggcgcgc
aactacgtcgatttcctcgccgactgcggcatctcggtctggcagatgttgccggtcgga
ccgactcagcgcgagctttcgccataccagacgagttccgcccatgccgggagctggcgc
ctgatcgcactggagccattggtggagcagggctggcttcaggccgaggagcttgcggcg
ctccagggcagtgatgagggcaaggcgcgggccctgagcctcgcctacggccgcttccaa
gaggcgggcgacacgagcgatcggcagggactcgagcgcttcgtcgccgagcactcctat
tggctcgaggactggtcgctcttctgggcgctgcgccaggagatcggtcagtgctggtgg
cattggcccgatgcgctacgccatcgcgacccgcaggaccttgcggcggcgcgggcacgg
ctctcggccgagatcgatttcatcgtcttcgagcagtacctgttcttcagccagtggcag
acgttgcgcgcctatgccgaggcccgtgggatccgtctcttcggcgacatgccgatcttc
gtcgcccacgacagcgccgaggtctgggcccgtccgcaggacttcgatctcaatcccgac
gggaccacgcgggtcgtcgccggggtgccgccggactatttttcggcgaccggccagcgc
tggggcaatccgctctatcgctggcaggagatggtcaacgacggtttccggttctggatc
gatcgcatccgcactcagctacgcctattccacatggtgcggatcgatcacttccgcggt
ttcgaggcctactgggagatcccggcgggcgagacctatgcgattcacgggcgctgggtc
aaggcacccggtgcggccctgttctcgcggctcaaccagtacttcggccagatcccgctg
atcgccgaggacctggggctgatcaccgaggaggtcgaagcgctgcgtaagcgcttccgg
ctgccgggcatgaaggtcctccagttcgccttctcgggcggggccgccaatccttacctg
cccttccaccacgatcgcgactcggtcgtctataccggcacccacgacaacgatacgacg
ctcggctggtatgaatcgctgagcgatgccgagcgtgcctatgtcggcgagtacctgggg
cgcccggccgagccgatgccctggccactcgtgcgttgcgcgttcgcctcgcgtgcccac
ctggcggtcgtgccgatgcaggacatcctgggactcgactcggcccaccggatgaatacc
cccgggaccgtcgatgcgaagaattggcagtggcgcttcgactggtcgagcgtcccgtcg
gatctgccggcgcgtatgcgccggctcgtcgccatctacgggcgcctggtcagctga

DBGET integrated database retrieval system