KEGG   Thioflavicoccus mobilis: Thimo_3334Help
Entry
Thimo_3334        CDS       T02397                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tmb00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3652391..3654172)
Genome map
AA seq 593 aa AA seqDB search
MCGIAGELRLDGAPADLESIAAMMGQLVRRGPDHGGSYSDGPLGLGHRRLAIIDLSVRSN
QPMVDPGLGLALVFNGTIYNYRALRRELTGKGYRFFSDGDTEVILKAWHAWGVDAPSRLD
GMFAFALWDANRRELFLVRDRFGIKPLYWSRDARRLRFASSTQALLAAGGVDPAIDPVAL
HHLFTLHAVVPAPRTILAGVRKLAPGHWLRLGADGRQEERAYWTLEATRPDPLPSEADWL
AAIHEALRAAVQSHKAAADVPVGVLLSGGLDSSLLVALLAEAGGVADLHTFSVGFEDTPE
EAGSEFEYSDQVVARYGTRHHRFLVPNADVLRRLPEAVDAMAEPMFGQDAVAFYLLGERV
AEEIKVVQSGQGADEVFGGYFWYPRMQADTAGNWTERFARHYFDRDHDEYLRLIAPAYAG
ADHSAALVAERLAEPGADEFLDAVLRLDVTTLIVDDPVKRVDNMTMAWGLEARVPFLDRR
LVELAARCPPALKLRDGGKFPLKAMARGRLPDAVIDRPKGYFPMPALKYVRGDFLAWMRD
LLDSRACRERGLYRRDYVEGLLAAPDQHHTRILGSKLWHLALLELWLQRHLDS
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtattgccggcgaattgcggctcgatggggcgccggccgatctggagtcgatc
gccgcgatgatggggcaactggtccgccgcggccccgaccacggcggcagctacagcgat
gggccgctcggcctcggccatcggcgcttggcgatcatcgacctctcggtgcgctcgaac
cagccgatggtcgatcccggactcggtctcgcgctggtcttcaacggcaccatctacaat
taccgcgcgctgcgccgcgagctgaccggcaagggctatcggttcttctccgacggcgac
accgaggtcatcctcaaggcctggcacgcctggggcgtggacgccccctcgcgcctcgat
gggatgttcgccttcgcgctctgggatgccaatcgtcgcgagctgttcctcgtccgcgac
cgcttcggcatcaagccgctctattggtcccgcgacgcccggcgcttgcgcttcgcctcc
agcacccaggccctgctcgccgccggcggggtcgacccggcgatcgatccggtcgccctg
caccacctcttcacgctccacgccgtcgtcccggcgccgcgcaccatccttgccggggtg
cgcaagctcgcccccggccactggctgaggctcggcgccgacggtcgccaggaggagcgc
gcctactggacgctggaggcgacccgacccgacccgttaccgagcgaggcggactggttg
gcggcgatccacgaggccttgcgcgccgccgtgcagagccacaaggccgccgccgatgta
ccggtcggcgtgctcctctccggcgggctcgactccagcctgctcgtcgcgctgctcgct
gaggccggcggcgtcgccgatctgcacaccttttcggtcggcttcgaggacaccccggag
gaggccggcagcgagttcgagtactccgatcaagtcgtggcccgttacggcacccgccac
catcgcttcctggtgccgaacgccgacgtcctgcgacggctaccggaggcggtcgatgcg
atggccgagccgatgttcggccaggacgcggtcgccttctacctgctcggggagcgggtc
gccgaggagatcaaggtggtccagtcggggcagggggcggacgaggtcttcggtggctac
ttctggtatccgcggatgcaggccgacaccgccggcaactggaccgagcggttcgcccgg
cactatttcgaccgcgatcatgacgaatacctgcgcctgatcgcgccggcctacgcgggc
gccgaccacagcgcggcattggtcgccgaacggctggcggaacccggggccgatgagttc
ctcgacgcggtgctgcgcctcgacgtcacgaccctgatcgtcgacgatccggtcaagcgc
gtcgacaacatgacgatggcctgggggctagaggcgcgcgtgcccttcctcgaccggcgc
ctcgtcgagctggccgcgcgctgcccgccggcgctcaagctccgcgacggaggcaagttc
ccgctcaaggcgatggcccgcggccggctgcccgatgccgtcatcgaccgacccaagggc
tacttcccgatgccggcgctcaaatacgtgcgcggcgatttcctcgcctggatgcgcgat
ctgctcgactcgcgggcctgccgcgagcgtggcctctatcggcgcgactatgtcgagggg
ctgctcgccgccccggatcagcatcacacccggatcctcggcagcaagctctggcacctg
gcgctgctcgagctctggctccagcggcacctcgattcctga

DBGET integrated database retrieval system