KEGG   Thioflavicoccus mobilis: Thimo_3607Help
Entry
Thimo_3607        CDS       T02397                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Thimo_3607
Enzymes [BR:tmb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Thimo_3607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3949934..3951472
Genome map
AA seq 512 aa AA seqDB search
MPETLLLRRVAIDTYHENVAYLHRDCRAYRSEGFQALNKVEIHPEGGGPLVLAVLNVVDD
PAITTPDELGLSEQAFAQLGVAAGTPVQIAQARPPGSLEAVHRKIQGKRLGREEYQAIAA
DIACNRYSKIEMSAFIVACAQAGLERDEVLSLTEAMIASGERLDWGEPLVVDKHCIGGVP
GNRTSLIVTPIVAAHGLLFPKTSSRAITSPAGTADTMECLARVALEPRELREIARRERGF
LAWGGTARLAPADDVLIAVERPLSLDSPGQMVASILAKKVAAGSTHLIVDIPVGPSAKIR
EGRDALYLRKLFELVGDCLGLHLEVMLTDGSQPVGRGVGPVLEARDAMQVLQDDPQAPAD
LREKSLVLAGRLLELDPGVRGGQGRTLAEEILTSGRALAKMEAIIEAQGRNREPPTLGAL
RHEVPAASDGVITAIDNRQIARIARLAGAPLDPGAGVDLYRRLGDPVRAGEALYAIHAQF
PADFHFARAQAGRDPGYRIGEPNHRARNGAGE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgccagagaccctgttgctgcggcgggtcgccatcgacacctatcacgagaacgtcgcc
tatctgcaccgcgactgccgcgcctaccgcagcgagggctttcaggccctgaacaaggtc
gagatccacccggaaggcggcggccccctggtgctcgccgtgctgaacgtggtggacgac
ccggcgattacgacacccgacgagctcggcctctccgagcaggccttcgcccagctcggc
gtggccgcgggcacgccggtgcagatcgcccaggcgcgcccgcccggctcgctcgaggcg
gttcaccgaaagattcagggcaagcggctcggacgtgaggagtatcaggcgatcgccgcc
gacatcgcctgcaaccgctattccaagatcgaaatgtcggccttcatcgtcgcctgcgcc
caggccgggctggagcgcgacgaggtcctctcgctgaccgaagcgatgatcgcgagcggc
gagcgcctcgactggggcgagccgctggtcgtcgacaagcactgcatcggcggcgtcccc
ggcaaccgcacatcgctgatcgtgacaccgatcgtcgccgcccacgggctgctcttcccg
aagacctcgagccgcgcgatcacctcaccggccggcaccgccgacaccatggagtgcctg
gcccgggtcgccctcgaaccgcgcgagctgcgcgagatcgcgcgccgcgagcgcggcttc
ctcgcctggggcggcacggcccggctggccccggccgacgatgtgctgatcgccgtcgag
cgccccctgtcgctcgactcaccggggcagatggtcgcctcgatcctggccaagaaggtc
gccgccggatcgactcacctgatcgtcgacatcccggtcggcccgagcgccaagatccgc
gagggccgcgacgccctctacctgcgcaagctcttcgagctggtcggcgactgcctcggc
ctgcacctggaggtcatgctgaccgacggctcgcagccggtcgggcgcggcgtcgggccg
gtgctcgaggcccgcgatgcgatgcaggtgttgcaagacgatccgcaggcgcccgccgac
ctgcgcgagaagtctctggtgctggccgggcggctgctcgagctcgacccgggcgtgcgc
ggcggccagggacgcacgctggccgaggagatcctgacctccgggcgggcgctggccaag
atggaggccatcatcgaggcccagggacgcaatcgcgagccaccgaccctcggcgctctg
cgccacgaggtgccggccgccagcgacggcgtgatcacggcgatcgacaaccgccagatc
gcgcgcatcgcccgcctcgccggcgcgccgctcgaccctggcgccggtgtcgacctctac
cgccgcctcggcgacccggtgcgcgccggcgaggccctttacgcgatccacgcccaattc
ccagcggacttccatttcgcccgcgcccaggccgggcgcgaccccggctaccgtatcggc
gagccgaaccaccgcgcgcggaatggggccggcgagtga

DBGET integrated database retrieval system