KEGG   Thioflavicoccus mobilis: Thimo_3611Help
Entry
Thimo_3611        CDS       T02397                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tmb  Thioflavicoccus mobilis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tmb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3953788..3954396
Genome map
AA seq 202 aa AA seqDB search
MIGRLRGEILAKHPPSLLLDVNGVGYELEAPMSTFYDLPAVGETVTLVTHLAVREDAHVL
YGFLREADRALFRHLLKVTGVGARMALAILSGMDAAQFARCITEADVAALTRLPGIGRKT
AERLVIEMKDRVAGLAEGPTLIVGRATPAAGGREAELADALSALVALGYKPADAQRMVAA
VTEEIATSEEIIRAALKAVGPR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgggcgcctgcgcggggagatcctcgccaagcatccgccgtcgctcctgctcgac
gtcaacggcgtcggctacgagctggaggcgccgatgtcgaccttctacgacctgccggcg
gtcggcgagacggtcaccctggtgacccatctcgccgtgcgcgaggacgcccatgtcctc
tacggtttcctgcgcgaggccgatcgggccctgttccgccacctgctcaaggtcaccggc
gtcggagcccgcatggcgctggcgatcctctccgggatggatgcggcccagttcgcgcgc
tgcatcacggaggcggacgtggcggccctgacccgcctgcccgggatcgggcgcaagacc
gccgagcggctcgtcatcgagatgaaggatcgcgtggccggactggccgaaggcccgacc
ctgatagtcggacgggcgacaccggctgcgggcgggcgcgaggccgagctggccgacgcc
ctgagcgccctggtcgcgctcggctacaagccggccgatgcccagcgcatggtcgcggcc
gtgaccgaggagatcgctacttcggaagaaatcatccgcgccgccctcaaggcggtcggc
ccgcgctga

DBGET integrated database retrieval system