KEGG   Tatlockia micdadei: LMI_0966Help
Entry
LMI_0966          CDS       T03810                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tmc  Tatlockia micdadei
Pathway
tmc00071  Fatty acid degradation
tmc00072  Synthesis and degradation of ketone bodies
tmc00280  Valine, leucine and isoleucine degradation
tmc00310  Lysine degradation
tmc00362  Benzoate degradation
tmc00380  Tryptophan metabolism
tmc00620  Pyruvate metabolism
tmc00630  Glyoxylate and dicarboxylate metabolism
tmc00640  Propanoate metabolism
tmc00650  Butanoate metabolism
tmc00900  Terpenoid backbone biosynthesis
tmc01100  Metabolic pathways
tmc01110  Biosynthesis of secondary metabolites
tmc01120  Microbial metabolism in diverse environments
tmc01130  Biosynthesis of antibiotics
tmc01200  Carbon metabolism
tmc01212  Fatty acid metabolism
tmc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMI_0966 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    LMI_0966 (thlA)
   00640 Propanoate metabolism
    LMI_0966 (thlA)
   00650 Butanoate metabolism
    LMI_0966 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    LMI_0966 (thlA)
   00072 Synthesis and degradation of ketone bodies
    LMI_0966 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMI_0966 (thlA)
   00310 Lysine degradation
    LMI_0966 (thlA)
   00380 Tryptophan metabolism
    LMI_0966 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMI_0966 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMI_0966 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LMI_0966 (thlA)
Enzymes [BR:tmc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMI_0966 (thlA)
Exosome [BR:tmc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMI_0966 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CEG60282
UniProt: A0A098GE60
Position
I:complement(978033..979223)
Genome map
AA seq 396 aa AA seqDB search
MNMEQNEIVIVAAKRTPMGNMLGALSPLSAPELGAVAHQAAMAQAKLSPADIDEVISGCV
LQAGIGQAPARQAAIKAGIPNSANATTINKMCGSGMKAVMLAHDLLKAGSANVILASGME
SMSNAPYLLSKARAGYRLGHGELKDHMFLDGLEDAYERGQLMGCFAEATASHFQFSRQQQ
DEFAARSLMRALQAQQNNAFAEEIAPVTIVDRKGEIVVKQDESPDESKLAKISQLRPAFK
ADGTVTAANSSSISDGAASLILMTAAYAKKRGLQPLARIIAHASHAQAPQWFTTAPVDAI
RKVLNKAGWHPGQVDLYEINEAFAVVAMAAITQLELDHEKVNIHGGACALGHPIGASGAR
IIVTLMHALKQKQKIRGIASLCIGGGEATAIAIEMM
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggaacaaaatgaaattgtaattgttgcagcaaaaagaacgccgatggggaat
atgcttggcgcattatcccctttatcagccccagaattaggtgctgttgcccaccaagca
gcaatggcccaagcaaaactgtcaccagctgatattgatgaggtcatcagcggctgtgtg
ctacaagcggggattggccaagcaccagcaaggcaagcggctatcaaagcaggtattcct
aattcagcaaacgccacaaccattaataaaatgtgtggttcaggtatgaaagctgtgatg
ttagcccatgatttacttaaagcaggctcagccaatgttattcttgcaagcggaatggaa
agcatgagtaatgcaccctacttgttaagtaaagcacgtgctggctaccgattaggacat
ggtgagctgaaagatcacatgtttttagatgggttagaggatgcgtatgaacggggtcaa
ttaatgggttgttttgcagaagcaacagccagccactttcaattttctcgtcaacaacaa
gatgagttcgctgcccgctctttgatgcgtgcattacaggcgcagcaaaataacgcattt
gcggaagaaattgctcctgtaaccattgttgatcgtaaaggtgagatcgtggtcaaacaa
gatgaaagccctgacgaaagcaaacttgccaaaatcagccaactacgacccgctttcaaa
gcagacggcacagtgaccgcagcaaattcaagctcgatttctgacggggctgcgagcttg
attttaatgactgctgcttatgcaaaaaaacgtgggctgcaacctctcgctcgaattatc
gctcatgctagccatgcccaagctcctcaatggtttactactgctcctgtcgatgccata
cgcaaggttttaaacaaagcgggttggcatccaggtcaggttgatttgtatgagattaat
gaggcctttgccgttgtcgctatggctgccattacccagcttgaactggatcatgaaaaa
gttaatattcatgggggggcttgtgcattgggccatccaattggtgcttccggagcacga
attattgtgacattaatgcatgcgttaaaacaaaaacaaaaaatacgcggtatcgcttct
ttatgcattggcggaggggaagctacagcaattgctatagaaatgatgtga

DBGET integrated database retrieval system