KEGG   Thermosipho melanesiensis: Tmel_0096Help
Entry
Tmel_0096         CDS       T00550                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tme  Thermosipho melanesiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
100684..101703
Genome map
AA seq 339 aa AA seqDB search
METKELILRLTSIAGPSGYETNVVDEIEKIMKNFSDETFKTKLGSLICVKKGNGKGKVGL
FAHVDQLGFVITKIDKKGFAYVAEIGGWDPKVVIGQRAKIISKDNKVFEGIFGFLAPHLQ
KKEEKGKVPSFNYLFLDISINKDWKEISVGDLVVLDNIEAFEQNSYIFSPALDNRASCAA
LIKTAELLQKIKHEVDVYFIFSTQEEEGGPGAPTAAYLSDLDYAFVVDVTHGNENVPGYE
KVEINKGPVVAIGPVVNREFNEIVRKTANEFNIQIQFEPIPRRSGTDTDEVQLVRKGIKT
QLLSIPLKYMHTPYEKISIQDIENTSKLITFTISALEVQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggaaacaaaagaattaattttaaggcttacttcaattgcaggaccatccgggtatgaa
acaaacgtggtagatgaaattgaaaaaataatgaaaaatttttcagatgaaacttttaaa
acaaaattaggtagtctaatctgcgtaaagaaaggaaatggaaaaggaaaagtaggactt
tttgctcatgtagaccaattggggttcgtaatcacaaagatagataaaaaaggattcgcc
tatgtagctgaaattggtggttgggatccaaaagtggtaattggtcagcgagcaaagata
atttcaaaagataacaaggtctttgaaggtatctttggatttttagccccccatttacaa
aagaaagaagaaaagggcaaagtgccatctttcaattatttgtttttagatattagcatc
aacaaagattggaaagaaatttcagtgggagacttagtggtactagacaatatagaagcc
tttgaacaaaacagctatatcttttcacctgctcttgacaatagggcaagttgtgcggct
ttaataaaaacagcggaacttcttcaaaaaataaagcatgaagttgacgtatactttatc
ttttcaacgcaggaagaggaagggggaccaggtgctccaaccgccgcttacctttcagac
cttgattatgcatttgtagtagatgttacacatggaaatgaaaatgttcccggatatgaa
aaggtagaaataaataaagggcctgtggttgcaattggtcctgttgtaaatagggaattc
aacgaaattgttagaaaaacggctaatgaatttaatattcaaatccaatttgaacctatt
cctagaagaagtggaacagatactgatgaggtacaattagtaagaaaaggtataaaaaca
caactgttatcaatacctttaaaatatatgcacacaccatatgaaaaaatctcaatccag
gatattgaaaatacatcaaaattgataacatttaccatttcggcattggaggtgcaataa

DBGET integrated database retrieval system