KEGG   Thermosipho melanesiensis: Tmel_0097Help
Entry
Tmel_0097         CDS       T00550                                 

Definition
(GenBank) Cellulase
Organism
tme  Thermosipho melanesiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
101703..102707
Genome map
AA seq 334 aa AA seqDB search
MYLKELSEINGVSGNEQKVRDFILDKIKDKVDKYWIDRMGNLIVFKKGKSKAKVVLDAHM
DEVGFMVTKINDDGTLSFMPVGGVDPRVVIGKKVIINDEIVGIIGFKAIHLQDSPYKTPE
FSQLSIDAGFSSKKEAEKKVKIGDYVAFTTKYKEVGNFATGKAFDDRGGCSILIDLIEKN
IKTDYDLYFVFSVQEETGLRGSAVVAEQIQPDFAIAIETTTAGDNPELDKELWATHLGEG
PAITFMHSGYVIDKNLFESLVKTAKDNNIPFQYKRRTAGGTNAARYARSAYGIPSAVISI
PSRYIHSPLIVINLEDYKNTVLLLQKFLEEAPIK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaaaagagctttctgagataaatggtgtttctggcaacgaacaaaaagttaga
gactttatcttagataaaatcaaggataaggttgataaatattggatagatagaatgggg
aatttaatagtgtttaaaaaagggaaatcaaaagctaaagttgtattagacgcacacatg
gatgaagtgggatttatggtaacaaaaataaatgatgatggaacattatcatttatgcca
gttggtggtgttgatcctagagttgtaataggtaaaaaagttataataaacgatgaaatt
gtaggaattattggatttaaagcaattcatttacaagatagtccttataaaactccagaa
ttttcacaactaagcattgatgcagggttttcttcaaaaaaagaagcagaaaaaaaagtt
aaaataggtgattacgttgcctttacgacaaaatacaaagaagtaggtaattttgccact
ggaaaggctttcgacgataggggtggatgtagtatactaattgatttaattgaaaaaaac
ataaaaactgattacgatctatattttgtatttagtgtacaagaagaaactggtttaaga
ggatcagcagtagtcgccgaacaaattcaaccagactttgctattgcaattgaaacaaca
actgcgggtgacaatccagaacttgataaggaactttgggcaactcatcttggtgaaggc
ccggcaattacatttatgcactctggttatgtaattgataaaaatctttttgaatcactt
gtaaaaactgcaaaagataataatataccattccaatacaaaagaaggactgctggaggt
acaaatgcagcaagatatgcaagaagtgcctatggtatcccatctgcagtaatatccata
ccttcaagatatattcatagtccacttatagttattaatttggaagactacaaaaacaca
gttttacttttacaaaaatttcttgaagaagctccaataaaataa

DBGET integrated database retrieval system