KEGG   Thermosipho melanesiensis: Tmel_0208Help
Entry
Tmel_0208         CDS       T00550                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tme  Thermosipho melanesiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
216055..217059
Genome map
AA seq 334 aa AA seqDB search
MKDLIRKLTETHSPSGREDEIRKVILSELDGFIDGYKVDKLGNLIVWKTGRSDRKILLDA
HMDEIGVVVTNIDDKGFLKIDMVGGVSPYTIFRSKIRFGDIIGIVDVEGETGAILSENIK
NLSFDKLYVDIGAKSREEAEKLCSIGTFGTFDGYFVEKGDFYISKSLDDRIGCAVIIETF
KRLKNPENTVYGVFAVQEEIGIVGARVAGYEIDPDVAIAIDVTGAGDTPKANKRISMKLG
SGACIKVKDGYSISDRKIVETLRNLAEKHNIPYQMEVLIYGGTDARGYQNTKAGIPSATI
SIATRYIHTPNEMVHKNDVEATIQLILKYIEEGL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatttaattaggaaactaactgaaacacatagcccaagcggaagagaagatgaa
attagaaaggtaattctttccgaacttgatggattcatcgatggttacaaagttgataaa
ttgggaaatttaattgtatggaaaaccggaagaagtgacagaaaaattctcttagatgca
catatggatgaaattggggttgtcgtaacaaatattgacgacaaaggttttttgaaaatt
gatatggttggtggagtatccccttatactatcttccgatctaagattagatttggagat
ataataggtattgttgacgtggaaggtgaaactggagctatactttccgaaaatattaaa
aacctatcttttgacaaactatatgtagatattggtgcaaaatcaagggaagaagcagaa
aaactatgttccattggaacatttggtacatttgatggctactttgtagaaaaaggagac
ttttatatatcaaaatccctggacgatagaataggatgcgcagtcataattgaaacattc
aaaaggctaaaaaaccccgaaaacactgtttacggtgtttttgcggtgcaagaggaaatt
ggaattgttggtgctagagttgctggatatgaaattgatcctgatgtagccattgcaatt
gatgttaccggtgctggagatactccaaaggcaaataaaagaatatcaatgaaattggga
agtggagcttgtattaaagtaaaagacgggtactcaattagtgatagaaaaatagttgaa
actttaagaaatctagctgaaaagcacaatataccatatcaaatggaagtgttaatttac
ggtggaacagatgcaagaggttatcaaaatacaaaagcaggtataccaagtgcaactatt
tcaattgcgactaggtatatacacaccccaaatgaaatggttcacaaaaatgatgtagaa
gcaacaatacaattaatactcaaatatattgaggagggactataa

DBGET integrated database retrieval system