KEGG   Thermosipho melanesiensis: Tmel_0340Help
Entry
Tmel_0340         CDS       T00550                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00010  Glycolysis / Gluconeogenesis
tme00020  Citrate cycle (TCA cycle)
tme00620  Pyruvate metabolism
tme00640  Propanoate metabolism
tme00650  Butanoate metabolism
tme00680  Methane metabolism
tme01100  Metabolic pathways
tme01120  Microbial metabolism in diverse environments
tme01130  Biosynthesis of antibiotics
tme01200  Carbon metabolism
Module
tme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmel_0340
   00020 Citrate cycle (TCA cycle)
    Tmel_0340
   00620 Pyruvate metabolism
    Tmel_0340
   00640 Propanoate metabolism
    Tmel_0340
   00650 Butanoate metabolism
    Tmel_0340
  Energy metabolism
   00680 Methane metabolism
    Tmel_0340
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tmel_0340
Enzymes [BR:tme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tmel_0340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ABR30210
JGI: Tmel0340
UniProt: A6LJV9
Position
347870..348445
Genome map
AA seq 191 aa AA seqDB search
MPAKYFEIRWHARAGQGAKSASQMLAEAALEMGKYVQSFPEYGAERTGAPMKAFNRVSDE
PILIHSSVDYPDVVVIIDDTMLGQPALTDGTDENTVFIVNTVKDVEYVREKLGVKGKICT
IAATDIALEELKRGIPNTVMLGAIAKVTGVITLESAEQRIRKAFSKKFPEELVEANVRAL
RRGFEEVKCNG
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcaaagtattttgaaataagatggcacgcaagagccggtcaaggtgcaaaaagt
gcttctcaaatgcttgcagaagcagctttagaaatgggaaaatatgttcaatcatttcct
gaatatggtgcagaaagaacaggggcaccaatgaaggcatttaaccgtgtttcagatgaa
ccaattttgattcacagttccgttgactaccctgacgttgttgtcattatagatgacaca
atgttaggacaacctgctttaactgatggaacagatgaaaacactgtatttatagtaaat
acagtaaaagatgtagaatacgtcagggaaaaattgggtgtgaaagggaagatttgtaca
atagccgcaacagatatcgcacttgaagagctaaaaagaggaattccaaatacagtcatg
cttggtgcaatagcaaaagttacaggagttattaccctggaaagtgccgagcaaagaata
aggaaagctttttcaaagaaattcccagaagagttagttgaagcaaatgtaagggcattg
cgccgtggatttgaggaggtgaagtgcaatggctga

DBGET integrated database retrieval system