KEGG   Thermosipho melanesiensis: Tmel_0342Help
Entry
Tmel_0342         CDS       T00550                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmel_0342
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmel_0342
   00020 Citrate cycle (TCA cycle)
    Tmel_0342
   00620 Pyruvate metabolism
    Tmel_0342
   00640 Propanoate metabolism
    Tmel_0342
   00650 Butanoate metabolism
    Tmel_0342
  Energy metabolism
   00680 Methane metabolism
    Tmel_0342
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tmel_0342
Enzymes [BR:tme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tmel_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
348784..349962
Genome map
AA seq 392 aa AA seqDB search
MPEIKNRQAVTGAQAIANAMRQINPDVVAAYPITPQTPVVEYFAQYVADGLADTEMIPVE
SEHSAMSAVVGAAAAGARAMTATAANGLALMHEIVYIAASSRLPIVMPVANRALSGPINI
HCDHSDAMAERDSGWIQLWAENAQEAYDFTIMAVRLAEHEDVRLPVMVNFDGFIISHGVE
VVDFLDDEVVKKFVGEPKVIYPLLDVEKPVTHGPLDLYDYYFEHKRQQIEAMKHVKKVFK
EIAEEFEKISGRKYDVLDKYKIDDAEYIMIALGSTAGTVKYTVDLLREEGHKVGVIKPQI
FRPFPKTELQELLNGRKAVIVLDRAASFGAEAPLYEAVKSALYEVAVRPQLGSYVYGLGG
RDIKVEHIKKAFEDAFSGNLIVDEERYLGLRE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgccagaaataaaaaatagacaagcagtaacaggtgcacaagcaattgcaaatgcaatg
cgtcaaataaatccagatgtagttgctgcatatccaattactccacaaactcctgtagtt
gaatactttgcgcaatatgttgcagatggacttgctgatacagaaatgattcccgttgaa
agtgaacatagtgcaatgagtgcagtagtaggtgctgctgctgcaggtgcaagggcaatg
acagcaactgctgctaacggtcttgcgttaatgcatgaaatcgtatatattgcagcttct
tcgagactcccaatagtaatgcctgttgcaaacagagctctttccgggcctattaacatt
cactgtgatcacagtgacgcaatggcagaaagagactctggatggattcaactttgggca
gaaaatgcacaagaagcctatgattttacgattatggcagttagattagcagaacatgaa
gatgtaagattacctgtaatggttaattttgatggttttatcatttcccacggtgttgaa
gtagtagactttttagatgatgaagtagttaagaaattcgttggtgaacctaaagttata
tatccacttcttgatgttgaaaaaccagttacacacggtccattagacctatacgactat
tactttgaacacaaaagacaacaaattgaagcaatgaaacatgtaaaaaaagtatttaaa
gaaattgctgaggaatttgaaaaaatttctggaagaaaatatgatgtattggataaatat
aaaatcgacgatgcagagtacataatgatagctcttggttcaactgcaggaactgtaaag
tacacggtagacttattaagggaagaaggtcacaaagttggtgtaataaaacctcaaatt
ttcagaccattcccaaaaacagaacttcaagaattattaaacggaagaaaagccgttatt
gtacttgatagagcagcttcttttggtgctgaagctcctttatatgaagctgtaaaaagt
gctctttatgaagttgctgttaggccacaacttggaagttacgtatacggtcttggtgga
agagatataaaggtcgaacatattaaaaaagcatttgaggatgcattttctggaaactta
atcgtagatgaagaaagataccttggacttagagaatga

DBGET integrated database retrieval system