KEGG   Thermosipho melanesiensis: Tmel_0343Help
Entry
Tmel_0343         CDS       T00550                                 

Definition
(RefSeq) thiamine pyrophosphate binding domain-containing protein
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmel_0343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmel_0343
   00020 Citrate cycle (TCA cycle)
    Tmel_0343
   00620 Pyruvate metabolism
    Tmel_0343
   00640 Propanoate metabolism
    Tmel_0343
   00650 Butanoate metabolism
    Tmel_0343
  Energy metabolism
   00680 Methane metabolism
    Tmel_0343
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tmel_0343
Enzymes [BR:tme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tmel_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
349976..350953
Genome map
AA seq 325 aa AA seqDB search
MAFNIMQLATKFADKNPGITQGHRLCPGCAAPNVAKFALMTAQAMGYEPIVGFATGCMEV
STTIYPYTAWNIPYIHNAFENAAATVSGIETAYRALLKKGRLVDPNKKYAFFAFGGDGGT
YDIGLQSLSGAVERGHKFIYIVYDNEGYMNTGNQRSGATPPGSQTTTQPVGKKLPGKIQL
KKNIVEIMAGHENVYVATVSTSEPMDFFKKIEKALEFDGPSFIAAISPCVRFWRVNDDKA
VEISKLAVETGYWPLYEVERGVYRVTKKVKELKPVKEFIEKQGRFRNLLKRPDADEIINE
LQEYIKRRWERLLALEEATKDKPIR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaatataatgcaacttgcaactaaatttgcagataaaaatcccggtattact
cagggacatcgactttgtcctggatgtgcagctccaaatgttgcaaaatttgctttaatg
acagctcaagctatgggatatgaaccaattgttggatttgcaacgggttgtatggaagtt
tctacaacaatttatccatatacagcatggaatattccatatattcacaacgcatttgaa
aacgctgctgcaactgtaagtggaatagaaacggcatacagagctctacttaaaaaagga
agattagtagatccaaataaaaaatatgctttctttgcatttggtggagatggcggaaca
tatgacataggtttacaatcactttcaggtgctgttgaaagaggacataagtttatctac
attgtttacgataatgaaggttacatgaatactggtaaccaaagatctggtgcaacacct
ccaggctcacaaacaaccactcaaccagttggtaaaaaattacctggaaagatacaatta
aaaaagaatattgttgagataatggcaggccatgaaaatgtttatgttgcaactgtatcc
acatctgaacctatggacttctttaaaaagattgaaaaagctctggaatttgatggccca
tcatttattgccgctatatctccatgtgtaagattttggagggtaaatgacgacaaagca
gtggaaatttccaaacttgcagtcgaaacaggttactggccattgtacgaagttgaaaga
ggagtctacagagttacaaagaaagttaaagaattaaaacctgtaaaagaatttatcgaa
aaacaaggcagatttagaaatcttttaaaaagaccagatgcagatgaaatcataaatgaa
cttcaagaatatattaaaagaagatgggaaaggttacttgcccttgaagaagccacaaaa
gataaaccaattagataa

DBGET integrated database retrieval system