KEGG   Thermosipho melanesiensis: Tmel_0343Help
Entry
Tmel_0343         CDS       T00550                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00010  Glycolysis / Gluconeogenesis
tme00020  Citrate cycle (TCA cycle)
tme00620  Pyruvate metabolism
tme00640  Propanoate metabolism
tme00650  Butanoate metabolism
tme00680  Methane metabolism
tme01100  Metabolic pathways
tme01120  Microbial metabolism in diverse environments
tme01130  Biosynthesis of antibiotics
tme01200  Carbon metabolism
Module
tme_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmel_0343
   00020 Citrate cycle (TCA cycle)
    Tmel_0343
   00620 Pyruvate metabolism
    Tmel_0343
   00640 Propanoate metabolism
    Tmel_0343
   00650 Butanoate metabolism
    Tmel_0343
  Energy metabolism
   00680 Methane metabolism
    Tmel_0343
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Tmel_0343
Enzymes [BR:tme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Tmel_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABR30213
JGI: Tmel0343
UniProt: A6LJW2
Position
349976..350953
Genome map
AA seq 325 aa AA seqDB search
MAFNIMQLATKFADKNPGITQGHRLCPGCAAPNVAKFALMTAQAMGYEPIVGFATGCMEV
STTIYPYTAWNIPYIHNAFENAAATVSGIETAYRALLKKGRLVDPNKKYAFFAFGGDGGT
YDIGLQSLSGAVERGHKFIYIVYDNEGYMNTGNQRSGATPPGSQTTTQPVGKKLPGKIQL
KKNIVEIMAGHENVYVATVSTSEPMDFFKKIEKALEFDGPSFIAAISPCVRFWRVNDDKA
VEISKLAVETGYWPLYEVERGVYRVTKKVKELKPVKEFIEKQGRFRNLLKRPDADEIINE
LQEYIKRRWERLLALEEATKDKPIR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcttttaatataatgcaacttgcaactaaatttgcagataaaaatcccggtattact
cagggacatcgactttgtcctggatgtgcagctccaaatgttgcaaaatttgctttaatg
acagctcaagctatgggatatgaaccaattgttggatttgcaacgggttgtatggaagtt
tctacaacaatttatccatatacagcatggaatattccatatattcacaacgcatttgaa
aacgctgctgcaactgtaagtggaatagaaacggcatacagagctctacttaaaaaagga
agattagtagatccaaataaaaaatatgctttctttgcatttggtggagatggcggaaca
tatgacataggtttacaatcactttcaggtgctgttgaaagaggacataagtttatctac
attgtttacgataatgaaggttacatgaatactggtaaccaaagatctggtgcaacacct
ccaggctcacaaacaaccactcaaccagttggtaaaaaattacctggaaagatacaatta
aaaaagaatattgttgagataatggcaggccatgaaaatgtttatgttgcaactgtatcc
acatctgaacctatggacttctttaaaaagattgaaaaagctctggaatttgatggccca
tcatttattgccgctatatctccatgtgtaagattttggagggtaaatgacgacaaagca
gtggaaatttccaaacttgcagtcgaaacaggttactggccattgtacgaagttgaaaga
ggagtctacagagttacaaagaaagttaaagaattaaaacctgtaaaagaatttatcgaa
aaacaaggcagatttagaaatcttttaaaaagaccagatgcagatgaaatcataaatgaa
cttcaagaatatattaaaagaagatgggaaaggttacttgcccttgaagaagccacaaaa
gataaaccaattagataa

DBGET integrated database retrieval system