KEGG   Thermosipho melanesiensis: Tmel_0423Help
Entry
Tmel_0423         CDS       T00550                                 

Definition
Alpha-galactosidase-like protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tme  Thermosipho melanesiensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tmel_0423
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tmel_0423
   00600 Sphingolipid metabolism
    Tmel_0423
Enzymes [BR:tme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tmel_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
449046..450713
Genome map
AA seq 555 aa AA seqDB search
MKIFGNNFDGEYIEIANNKYTLKLKIENIPEGYIIRGKIKGKLRNIKLFEDNSDEELFIN
NWQSWGPAKKICLSKYEYNVPEKWKKTAKYSIHPIPKYLENNVISDYFIAKRNKVYGFLT
SKTAHPFFKVKNDKIVAILEYFGKYTDKYIDIEPLIILENENIEKLLEIYADYVTFENKP
RFSKQNPVGWSSWYYYFEKLTWNDVLKNLELSKEYNYEIFQLDDSWQKDIGDWIPKSSYP
NLEEITKKISEYGYIPGLWLAPFSVSETSTIYSNHKDWLVKDESGKPKVAYINWNKNIYA
LDTTHPDVQEHLRKTFFNFMKVGFHYFKIDFLFAGAIPGKRHLDVTPIEAYIMGMKIIRK
TTKNNFILGCGAPLLPSVGYVDGMRISADTAPFYDSQKLDFLYPNAFYALRNVITRYFVN
GKWWWNDPDCLLLRLENTNLSENVIEMYSYVSGVLNNMIIQSDNLSKNIRKSIFSNTLKL
RGGIPHVKGFMDENLIFEINSFGTTSGNIKMLVDLKKEKFEMEKDEDYPHLKKETVVRKD
DMRLFHYYKENDKDA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaagatatttggaaacaattttgatggtgaatatatagaaatagcaaataataaatac
accctgaaattaaaaatagaaaatatacctgaaggttatattattcgaggaaaaataaaa
ggaaagttgagaaatataaaactatttgaagataactcagatgaagagttatttatcaac
aactggcaaagttggggaccagctaaaaaaatatgcttgtcaaaatatgaatacaacgta
cctgaaaagtggaaaaaaactgcaaaatatagtattcatccaattccaaaatacttagaa
aataatgttatttctgactacttcatagctaaaagaaacaaggtctacggctttttaact
tcaaaaactgctcatccattttttaaagttaaaaatgataagatagttgctattctagaa
tatttcggcaaatacacagataaatatattgatattgaacctttgataattttagaaaat
gaaaatattgaaaaactacttgaaatatatgcagattacgttacttttgaaaataaacct
cgtttctcaaaacaaaatccagttggttggtcctcctggtattactactttgaaaaactt
acttggaacgacgtattgaaaaacctggaactttcaaaagaatataactatgagatcttt
caattagatgattcctggcaaaaagatataggggattggattcccaaatcgtcttatcca
aatctggaagaaatcaccaaaaaaatcagtgaatacggatatatccctggtctatggctt
gcaccttttagtgtatctgaaacatccactatctactcaaatcacaaagattggctagta
aaagatgagtctggaaaacccaaggttgcatacatcaattggaataaaaatatctacgca
ttagataccactcatccagatgtacaagagcatttaagaaaaacgttttttaactttatg
aaagttggttttcattactttaaaatagactttctctttgcgggtgctatcccaggaaaa
aggcatttagatgtaactcctattgaggcgtatattatgggaatgaaaataataaggaaa
accacaaaaaacaactttatattaggatgcggtgcacctttattaccttctgtgggatat
gtagatggaatgaggataagtgcggataccgcacctttttacgatagtcaaaaattagat
ttcctatatccaaatgcattctacgctttaagaaacgttattacaagatattttgtgaat
ggaaagtggtggtggaacgatcccgattgtttattgttaaggttagaaaatacaaattta
agtgaaaatgtcattgaaatgtattcatatgtgtcaggtgtgctaaataatatgatcatc
caaagcgacaatttatcaaaaaatattagaaaaagtatattcagtaacactttaaaatta
agagggggaattccacatgtaaaaggatttatggatgagaatctgatattcgaaatcaac
tcttttggcacaacaagtggaaatatcaagatgctggtagatcttaaaaaggaaaagttt
gaaatggaaaaagatgaggattatcctcatctaaaaaaagaaacagttgtaagaaaagat
gatatgagattattccattattacaaggagaatgataaagatgcttga

DBGET integrated database retrieval system