KEGG   Thermosipho melanesiensis: Tmel_0617Help
Entry
Tmel_0617         CDS       T00550                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tme00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(658800..660269)
Genome map
AA seq 489 aa AA seqDB search
MVFILALDQGTTSSRAILFDENGQSVFVKNKEYKQIYPKPGWVEHDPFDILNSQIEVAKL
AVDTVGYENIAAIGITNQRETTILWNKRTGKPVYNAIVWQCRRTADICERLKEDGYENLI
KEKTGLVIDAYFSGTKIKWILDNVPGVREEAEKGNILFGTVDSWLIWNLTGGKVHVIDYS
NASRTMLFNINTLKWDEEILEILNIPKSILPTPVPSSMVYGYTEVFGGRIPIAGDAGDQQ
ASLFGQTCFDKGMIKNTYGTGCFILMNTGEKPYYSNSGLLATIAWGVDDKVDYALEGSIF
IAGAAVQWLRDNLKIIESAYETEEIAFSVPDSGELYFVPAMVGLGAPYWDMYARGLLIGI
TRGTTRAHIVRAVLESIAYQTRDVLEVMAKESGIEMGTLRVDGGASNNNFLMQFQADILG
IPVERPEITETTALGAAYLAGLATGVWKTKEEIKWNLNKRFEPKINKEQRKKLYGKWKEA
VKRSMKWSE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggtgttcattttggcgctggatcaaggaacaactagttcacgagctatattatttgat
gaaaacggacaaagtgtttttgtaaagaataaagaatacaaacagatatatccaaaacct
ggctgggtagaacatgatccatttgatattttaaactcccaaattgaagtggcaaagtta
gcagtagatactgttggatatgaaaatatagctgcaattggtataactaatcaaagagaa
acaaccattttgtggaataaaagaactgggaaacctgtatataatgcaatagtttggcaa
tgtagaaggacagcagatatttgtgaaagattaaaagaagatggatatgagaatttaata
aaagaaaaaacagggcttgttatagatgcttatttttcaggtactaaaatcaaatggata
cttgataatgttccaggggtaagagaagaagcagaaaagggaaatatactttttggaaca
gtagattcttggcttatctggaaccttacaggtggtaaggttcacgttatagattactca
aatgcatcaaggaccatgctatttaatattaatactctaaaatgggatgaagaaatttta
gagatattgaatataccaaaaagtatattacctacaccagttccttccagcatggtgtat
ggatatactgaagtttttggtgggagaataccaatagcaggggatgcgggagatcaacaa
gcctctctttttggacaaacgtgctttgataagggaatgataaaaaatacgtacggtaca
ggttgttttatattgatgaatacaggcgaaaaaccttattactcaaattctggattgctt
gcgacgatagcttggggagtagatgataaagtagactatgcgttggagggaagtatattt
attgccggtgcagccgtacagtggttgagagataatctaaaaattattgagagtgcttat
gagacggaagaaatagcattttctgttccagattcaggggagctttactttgttcctgca
atggtaggattaggtgcgccatattgggatatgtatgcaagagggcttttaatcggaatc
acgagaggtacaacaagagctcatattgtaagggcggttttggaatcaatagcttatcag
acaagagatgttttagaagtaatggcaaaggaatctggaattgaaatgggaacgctcaga
gttgatggcggggcttccaataataactttttaatgcagtttcaggcagatattcttgga
atacctgtggaaagaccagagattactgaaacaactgctttgggggcagcatatcttgca
gggcttgcaacgggtgtatggaaaactaaggaagaaataaagtggaatcttaataagaga
tttgaacctaagattaacaaagagcaaaggaaaaagttatatggaaaatggaaagaagca
gtgaaaaggtcgatgaaatggagtgaatga

DBGET integrated database retrieval system