KEGG   Thermosipho melanesiensis: Tmel_0646Help
Entry
Tmel_0646         CDS       T00550                                 

Definition
dihydrofolate reductase region
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tme  Thermosipho melanesiensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tme00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:tme00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
684379..684867
Genome map
AA seq 162 aa AA seqDB search
MHLIMVVVTDIFGGFTINEYDPIDWGSIEDKKHFRDLTTKIGTVIMGRKTFESIGKPLKD
RLNIVLTNKNFKNDKNILFLKGNPQEIISSLEKKNIKSAAVIGGKKVFEEFFPYIDKIFI
TIEPIILENSQKLSFKRENFKLITTNVLNERGTIVLEYEKLP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcataatggtggttgttacagatatatttggtggctttactataaacgaatat
gatcctatagattggggatcaatagaagataaaaaacactttagagatcttaccacaaaa
ataggaacagttataatggggcgaaaaacttttgaaagtattggaaaacctttaaaagat
agattaaatattgtacttacaaataaaaattttaaaaatgataaaaacattctctttcta
aaaggcaatccccaagaaattatatcatcccttgaaaagaaaaacataaaaagtgccgcg
gtaattggcggaaaaaaagtctttgaagaattttttccatacatagataaaatatttatc
acaatcgaacctatcatattggaaaactcacaaaaattatcgtttaaaagagagaatttt
aaattaataaccacaaatgttctaaatgaaagaggaacaatagttctcgaatatgaaaaa
ctaccctaa

DBGET integrated database retrieval system