KEGG   Thermosipho melanesiensis: Tmel_0689Help
Entry
Tmel_0689         CDS       T00550                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tme  Thermosipho melanesiensis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tmel_0689
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Tmel_0689
Enzymes [BR:tme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tmel_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
728218..729549
Genome map
AA seq 443 aa AA seqDB search
MLDDFGNLLFIGFQQSLNTEIIKKYNPTGVILYPKNMEDVYLLQIIMEKLYTLMDHGYRF
LISSDHEGGQLETIPNIFPSPGNLAIGKVGRAYSYGEYLGKMLKMHGFNMVFAPVVDVKH
PNSSHVTGFRAYSSDHKIVEKSAKEFILGLKKHKIAATLKHFPGHGKAIEDSHFTLPVVK
DFVENDNDILIFKNLSKEVDFIMTAHILYPKIDNVIATLSKKFLTNILKEKYKYNGLIIS
DALEMKALYDNYSPKEIIKKFFESGGDILLIGDIEKHFEIVNTFYSMIKNKELDVDFLKE
KISKIKKIKEKYIEPTYYARFLSDIAKKAIEYNLKSPTKNPDFLIPTPKNLSLADTSEKD
LKHLKLLIKTEFPKSKIFEKKYEFEDTVVYFVLDKVKKIRAKRVVYVFLRKFFNTTNEYI
LPYSSKLISIYHVLQLLKGEGLT
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgatgactttggaaatttactatttataggatttcaacaatcattaaacacagaa
ataataaaaaagtacaatcccacaggtgtaattttatatcccaaaaatatggaagatgtt
tatttattacaaataattatggaaaaactctatactctaatggaccatgggtatagattt
ctcatatcctcagaccacgaaggaggtcaacttgaaaccatacctaacatttttccctca
cctggaaatctcgcaataggaaaagtgggcagagcatacagttacggtgaataccttggc
aaaatgttgaagatgcatggatttaacatggtatttgctcctgttgtcgatgtaaaacac
cccaattcaagtcatgtcactggttttagagcttattcaagcgaccacaagattgtcgaa
aaaagcgcaaaagaatttatccttggcctaaaaaaacacaaaattgcagcaacattaaaa
catttcccaggacatggaaaagcaatagaagattcccactttacacttcctgtagttaaa
gactttgttgaaaatgataacgatatattaatattcaaaaacttgtcaaaagaagtagat
ttcattatgactgcacatatactttatcccaaaatcgataatgtaatcgctacactatca
aaaaaattcctaacaaatatcttgaaagaaaagtataaatacaacggattaataatctca
gatgcactagaaatgaaagcgttatatgacaattactctcccaaagaaattatcaaaaaa
ttctttgaatcaggtggagatatcttattaataggcgatatagaaaagcattttgaaatt
gtaaatacattttactcgatgattaaaaacaaagaacttgatgttgattttctaaaagaa
aaaatttccaaaataaaaaaaataaaggaaaaatatatagaacccacatattatgcaaga
tttctttcagatattgcaaaaaaagccatagaatacaaccttaaatcacctacaaaaaac
cccgactttttaatccccactccaaaaaatctaagccttgcagacacctcagaaaaagat
ttaaaacatttaaaactcttaattaaaacagaatttccaaaatcaaaaatttttgaaaaa
aaatacgaatttgaagacacggtagtttattttgtcttagacaaagtaaaaaaaatacgt
gcaaaaagggttgtctacgtatttttaagaaaattttttaacacaacaaatgaatatatt
cttccatattcttctaaattaatatccatataccatgtcttacaacttctaaaaggggag
ggattaacatga

DBGET integrated database retrieval system