KEGG   Thermosipho melanesiensis: Tmel_0725Help
Entry
Tmel_0725         CDS       T00550                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tme  Thermosipho melanesiensis
Pathway
tme00260  Glycine, serine and threonine metabolism
tme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tme01100  Metabolic pathways
tme01110  Biosynthesis of secondary metabolites
tme01130  Biosynthesis of antibiotics
tme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmel_0725
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmel_0725
Enzymes [BR:tme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmel_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP RhoGAP Sirohm_synth_M
Motif
Other DBs
NCBI-ProteinID: ABR30589
JGI: Tmel0725
UniProt: A6LKY8
Position
complement(762071..763327)
Genome map
AA seq 418 aa AA seqDB search
MRVIYLSTEEMPRHWYNVLSDLPFELDPPLDPETTNPISPEKLLKIFPEPLLEQEMTKKR
FIEIPDEVLKEYLRFRPTPLIRAKFLEEYLDTPAKIFYKYEGVSPTGSHKTNTAIAQVYY
NRISGTKVLYTETGAGQWGSALSYAGLKFNIPVKVFMVRVSFEQKPMRKQLMNLFGGDVV
PSPSKFTEFGKSFDENHPGSLGIAISEAMEKVLNEEGAKYSLGSVLNHVLLHQTVIGLEI
KKQLEKVNLEPDVIIACHGGGSNFGGTVFPFVPDKLSGKNVDFVACEPESCPTLTKGVYR
YDFGDSSGLTPLLKMYTLGKDFIPPKIHAGGLRYHGASPIISRLVKEEIIRAESFSQDET
FNAARIFAKVEGIVPAPESAHAIAGAIREAKRAKEEKREKVIVFTLSGHGLFDLSAYS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagggttatttatctaagcactgaggagatgccaaggcattggtataacgttctttca
gatttgccttttgaattagatccaccacttgatcctgagacgacaaatcccatttctccg
gaaaagcttttaaagatttttccagagcctttgcttgaacaggagatgactaaaaaaaga
tttatagaaattccagatgaagtactaaaggagtatttaagatttagaccaactccacta
attagggcaaaatttttggaagagtatctagatactcctgcaaagattttttacaaatac
gaaggtgtaagtccaacagggagtcataaaacaaatacggcaatagcgcaggtgtattac
aataggatttctggaacaaaggtgttgtacactgaaacaggtgcgggacaatggggaagt
gctttatcttacgcagggttaaaattcaatattcctgtaaaagtgtttatggtaagagta
agctttgagcaaaaaccaatgagaaaacaacttatgaatctttttggtggagatgtggta
ccatcgcctagtaaatttacagagtttggtaagagttttgatgaaaatcatccgggaagt
ttgggtatagccattagtgaggctatggaaaaagtgttaaacgaggaaggtgcaaaatat
tctttgggaagtgttttaaatcatgtgttgttgcatcaaacggtaatagggcttgaaata
aaaaaacaacttgaaaaagttaatttagaacctgatgtaataatagcgtgtcatggtgga
ggttcaaattttggcggaacagtttttccttttgttccagataaactttctggaaaaaat
gtggattttgttgcatgtgagccggaaagttgtcctactttgacaaaaggagtatataga
tatgattttggtgatagttctggtttaactcctttgttgaagatgtataccttgggaaaa
gattttattccaccaaagattcatgcaggtggcttaagatatcatggtgcttcaccaata
atttcgcgtcttgtaaaagaagaaataattcgtgcagaaagtttttcgcaagatgaaaca
tttaatgcagcaaggatatttgcaaaggttgaaggaattgttccagctcctgaatcggct
catgctatagcaggcgcaataagggaagcaaaaagggcaaaggaggaaaaaagagaaaag
gttattgtttttacactatcagggcatggattatttgatttaagtgcatatagttaa

DBGET integrated database retrieval system