KEGG   Thermosipho melanesiensis: Tmel_0725Help
Entry
Tmel_0725         CDS       T00550                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmel_0725
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmel_0725
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmel_0725
Enzymes [BR:tme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tmel_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(762071..763327)
Genome map
AA seq 418 aa AA seqDB search
MRVIYLSTEEMPRHWYNVLSDLPFELDPPLDPETTNPISPEKLLKIFPEPLLEQEMTKKR
FIEIPDEVLKEYLRFRPTPLIRAKFLEEYLDTPAKIFYKYEGVSPTGSHKTNTAIAQVYY
NRISGTKVLYTETGAGQWGSALSYAGLKFNIPVKVFMVRVSFEQKPMRKQLMNLFGGDVV
PSPSKFTEFGKSFDENHPGSLGIAISEAMEKVLNEEGAKYSLGSVLNHVLLHQTVIGLEI
KKQLEKVNLEPDVIIACHGGGSNFGGTVFPFVPDKLSGKNVDFVACEPESCPTLTKGVYR
YDFGDSSGLTPLLKMYTLGKDFIPPKIHAGGLRYHGASPIISRLVKEEIIRAESFSQDET
FNAARIFAKVEGIVPAPESAHAIAGAIREAKRAKEEKREKVIVFTLSGHGLFDLSAYS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagggttatttatctaagcactgaggagatgccaaggcattggtataacgttctttca
gatttgccttttgaattagatccaccacttgatcctgagacgacaaatcccatttctccg
gaaaagcttttaaagatttttccagagcctttgcttgaacaggagatgactaaaaaaaga
tttatagaaattccagatgaagtactaaaggagtatttaagatttagaccaactccacta
attagggcaaaatttttggaagagtatctagatactcctgcaaagattttttacaaatac
gaaggtgtaagtccaacagggagtcataaaacaaatacggcaatagcgcaggtgtattac
aataggatttctggaacaaaggtgttgtacactgaaacaggtgcgggacaatggggaagt
gctttatcttacgcagggttaaaattcaatattcctgtaaaagtgtttatggtaagagta
agctttgagcaaaaaccaatgagaaaacaacttatgaatctttttggtggagatgtggta
ccatcgcctagtaaatttacagagtttggtaagagttttgatgaaaatcatccgggaagt
ttgggtatagccattagtgaggctatggaaaaagtgttaaacgaggaaggtgcaaaatat
tctttgggaagtgttttaaatcatgtgttgttgcatcaaacggtaatagggcttgaaata
aaaaaacaacttgaaaaagttaatttagaacctgatgtaataatagcgtgtcatggtgga
ggttcaaattttggcggaacagtttttccttttgttccagataaactttctggaaaaaat
gtggattttgttgcatgtgagccggaaagttgtcctactttgacaaaaggagtatataga
tatgattttggtgatagttctggtttaactcctttgttgaagatgtataccttgggaaaa
gattttattccaccaaagattcatgcaggtggcttaagatatcatggtgcttcaccaata
atttcgcgtcttgtaaaagaagaaataattcgtgcagaaagtttttcgcaagatgaaaca
tttaatgcagcaaggatatttgcaaaggttgaaggaattgttccagctcctgaatcggct
catgctatagcaggcgcaataagggaagcaaaaagggcaaaggaggaaaaaagagaaaag
gttattgtttttacactatcagggcatggattatttgatttaagtgcatatagttaa

DBGET integrated database retrieval system