KEGG   Thermosipho melanesiensis: Tmel_0765Help
Entry
Tmel_0765         CDS       T00550                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tme  Thermosipho melanesiensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tmel_0765
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tmel_0765
   00600 Sphingolipid metabolism
    Tmel_0765
Enzymes [BR:tme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tmel_0765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
807020..808444
Genome map
AA seq 474 aa AA seqDB search
MFKVAIVGAGSAVFSLRIISDFTKITEFKDVEIYLMDIDETRLNSTFILANKLNEEMGSK
LKFKTTTNLEEAIDGAMFVINTAMAGGHDYLEKVRKIGEKWGYYRGIDTQEFNMVSDYYT
ISNFNQLDLFLKVARLVEEKGEKGAWLLQAANPVFEGTTLILRNVSINMVGFCHGHYGIH
YLAETIGLEMNKVDWQVAGVNHGIWLNRFLYNGKNAYEILDEWIKNNVYEPRHPFDDQLS
KVAIDMYKFYGQMPIGDTVRNSSWKYHYNLETKKKWYGKFGGADSEIGWKWYQDNLKAIT
ETINKLAYFVSQNSNIKLLDYNLYKDYLNIEIFKEEIERIIDTEKLSGEQHVPFIDSIVN
NKRQRFVVNILNNGVIEGIDNDVAVEIPAWVDSSGIHSEEITPKLSERVIKYYLRPRIMR
MELASEAFLSGDIKLLKEILFRDPRTKSEEQVEGVLNEIMNLPENEKMRKHYIL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagtagcaatagttggtgctggaagcgccgttttttcattgagaattattagt
gattttactaaaatcactgaatttaaagatgttgaaatctatctaatggatattgatgaa
acaagattaaattcaacatttatacttgcaaataaattaaatgaagaaatgggctcaaaa
ttaaaatttaaaaccactacaaaccttgaggaagcaattgatggagcaatgtttgtaatt
aatacagcaatggcaggaggacatgattatttagaaaaagttagaaaaataggggaaaaa
tggggatactatagaggaattgatacgcaagagttcaacatggtgtcagattattacaca
atatcaaatttcaatcaactggatttatttttaaaagtcgcaagattggttgaagaaaag
ggagaaaaaggggcatggttgcttcaagcggcaaatcctgtatttgaaggaacaacattg
attttaagaaatgtgtctataaacatggtggggttttgccacggacactatggcatacat
tatttagcagaaacaataggattggaaatgaataaagtagattggcaagttgcaggtgtt
aatcatggaatatggttaaacagatttttgtataatggtaaaaacgcttatgaaatatta
gatgaatggataaaaaataatgtttacgaaccaagacatccattcgatgaccaactctca
aaagttgcgatagatatgtataaattttacggacaaatgccaattggagatacagtgaga
aattcttcttggaaataccactataacctagaaacaaagaaaaaatggtatggaaaattt
ggtggtgcagactctgaaataggttggaaatggtatcaagataatctaaaggccattacc
gaaacaataaacaaacttgcatattttgtttctcaaaattccaatattaaattgttggat
tacaacctttacaaagattatttgaatattgaaatcttcaaggaagaaattgaaagaatt
attgacaccgaaaaactaagtggagaacaacacgttccatttatagattcaatagttaac
aataaaagacaaagatttgttgtaaacatattaaataatggagtcatagaaggaatagat
aatgatgttgcagttgaaattcccgcatgggttgattcttctggaatacattctgaagaa
attacaccaaaactatcagaaagagtaattaaatactacttaaggccaagaattatgagg
atggaactggcatcagaagctttcttatctggagatatcaagcttttaaaagaaattctc
tttagggatccaagaacaaaatctgaagagcaggtggaaggagtattaaatgagataatg
aatttaccagaaaatgaaaaaatgaggaagcattacattttatga

DBGET integrated database retrieval system