KEGG   Thermosipho melanesiensis: Tmel_0806Help
Entry
Tmel_0806         CDS       T00550                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmel_0806
   01230 Biosynthesis of amino acids
    Tmel_0806
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmel_0806
   00030 Pentose phosphate pathway
    Tmel_0806
   00051 Fructose and mannose metabolism
    Tmel_0806
   00052 Galactose metabolism
    Tmel_0806
  Energy metabolism
   00680 Methane metabolism
    Tmel_0806
Enzymes [BR:tme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tmel_0806
Protein phosphatases and associated proteins [BR:tme01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tmel_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(846071..847255)
Genome map
AA seq 394 aa AA seqDB search
MKVLYAQSGGVTSVINASAYGILDEAQKAGLEVYVGIHGISGVLKENLLKINGKSIDGLK
YTPSAAFGSCRRKLKSQEDINKLFEIFEKYEIEYFFYNGGNDSMDTAWKLYTEAKKRNTP
LKVIGVPKTIDNDLPYTDHCPGYGSAAKYVAIAIMEATLDLRSMYVDSTRVFVMEIMGRH
AGWLVAAAGLGWLNGIGADIILFPEVPFNKEKFLDKVDETIRKKGYCSIAVSEGIRYPDG
FFVADMGYTDSFGNRQLGGVGFTIAGMIRSELSLKTHVAIPDYLQRSGRHIASRTDIEEA
EGVGRQAVKLALDGISGVMVTINRISDNPYKIEYSTIELNKVADKTKYLPEEFHKDFEVT
EKYFKYAKPLIEGELFPEFKNGLPNYTIFKEVDG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttctatacgcacaatctggtggtgttacaagtgtaattaacgcatctgcttat
ggtattcttgatgaggcacaaaaggcaggtttagaagtttatgtgggaattcacggtatt
tctggggtattaaaagaaaatcttttaaaaattaacggaaaaagcatcgacgggttaaaa
tacacaccttctgctgctttcggttcatgtagaagaaaattaaaaagtcaagaagatatt
aataagctttttgaaatttttgaaaaatatgaaatagaatatttcttttataatggcggt
aacgattctatggataccgcttggaaattatataccgaagcaaaaaaaagaaatacaccc
ctaaaagttattggtgtaccaaaaacaatagataatgatttaccatataccgatcattgt
ccgggatatggttctgcagcaaaatatgtcgcaattgctattatggaagcaacattagat
ttgaggagtatgtatgtagattccacaagggtttttgtcatggaaataatgggaagacat
gccggatggcttgtggcagctgcaggtttaggttggttaaatggaataggagcagatata
attttgttccctgaagtacctttcaacaaggaaaagtttttggataaggtagatgaaaca
ataagaaaaaaagggtattgctccatagccgtatcagaaggaattagatatccagatggt
ttctttgtagcagatatgggatataccgatagttttggaaatagacaactaggtggtgtg
ggctttaccattgcaggtatgattagatctgagctgtccttaaaaacacacgttgcaatc
ccagattatttacaaagaagtggaagacatattgcaagtagaacggatatagaagaagct
gaaggtgtgggaagacaagctgtaaaattagcacttgacggtatatctggtgtaatggtt
accataaacagaattagcgataatccttacaaaatagaatacagcactatcgaactgaat
aaagttgcagataaaacaaaatatcttccagaggagtttcacaaagattttgaagttaca
gagaaatactttaaatatgcaaaacccttaatagaaggtgaattgttccctgaatttaaa
aatggtttgccaaactacacaatttttaaggaggttgacgggtaa

DBGET integrated database retrieval system