KEGG   Thermosipho melanesiensis: Tmel_0869Help
Entry
Tmel_0869         CDS       T00550                                 

Definition
esterase/lipase-like protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tme  Thermosipho melanesiensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
904437..905210
Genome map
AA seq 257 aa AA seqDB search
MSLFELKDVKTVTVSQPLFLKGSTGKGVLLIHGYTGSPHDMVYLANRLNEEGYTVLVPRL
PGHGTSSKDFLESNWRDWLRRGLDSYFDLSGLCEEVYIGGLSMGGVLALILASIVNPKKI
VSIAGAIFTVDKRIALTPLISLFTKKMKRKIYFEKYENKDLEYLSKEYWSYNWPLQAKYL
YKLMKIARKRIRLIRSDILILASEKDETVPLKAAHYIYNNVSSEKRKLEVFKESGHVMTN
DVEKEKVADKIIEWFRE
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagtctttttgagttaaaagacgtcaagactgtaacagtttcacaacctttatttttg
aaaggtagcaccgggaaaggtgttttattaatccacggttatacgggaagtccacacgat
atggtatatttagcaaatagattaaatgaagaaggatatactgttttagttccaagatta
ccgggacatggtacttcttcaaaagattttcttgagagtaactggagggattggcttaga
aggggtttggatagttattttgatttatcaggtttatgtgaagaagtttacattggagga
ctttctatgggtggggttttagctttaattttggcgagcatagttaatcctaaaaagatt
gtttccattgctggagcaatttttacggtggataaaagaattgcattaacacctttaatt
tccttatttacaaaaaagatgaaaaggaaaatttattttgaaaagtatgaaaacaaagat
ttagagtatttgtccaaagaatattggtcatataactggcctttacaggcaaaatattta
tacaaattaatgaagatagctagaaagaggattagattaataagatcagatattttgatt
ttagcttctgaaaaagacgaaactgtacctttaaaagcagctcattatatatataataac
gtttcttcggaaaaaagaaaattggaagttttcaaagaatcaggacatgttatgacaaat
gatgtggaaaaggaaaaagtggcagataaaataatagaatggtttagagaatag

DBGET integrated database retrieval system