KEGG   Thermosipho melanesiensis: Tmel_0911Help
Entry
Tmel_0911         CDS       T00550                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tme  Thermosipho melanesiensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tme03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
949037..949606
Genome map
AA seq 189 aa AA seqDB search
MIYAMYGVLEDIENGKLYLNVNEIVYEIVVGDTGYFEDFLNEKIKVFTKMIVNDDEISLY
GFSDVLKLKLFEKLILVNKLGPKSALKIITSSDVSYIVSAIVNEDVKTLSTLPGIGPKTA
ERIILELKDSMKEFDVTLTEKDKKILEAIEALVTLGFSRNQSKKAVTQILKKDDSLDDII
KKALKFLSR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtgatctatgcaatgtatggtgtattggaagacatcgaaaatggaaaattgtatttaaat
gtgaatgaaattgtatatgagatagtagttggcgatacaggttatttcgaagattttttg
aatgaaaaaataaaagtatttacaaagatgattgtaaatgacgatgaaataagtttatac
ggtttttcagatgttttgaaactaaagttatttgagaaacttattttggttaacaaacta
ggcccaaagagtgctctaaaaataattacttcaagtgatgtttcatatattgtaagtgct
attgtaaatgaagatgttaaaacattatctacacttccaggaataggtccaaaaacagca
gaaaggattatattagaactaaaagattctatgaaagaatttgatgtaactttaacggaa
aaggataaaaagattttagaggcaatagaagcattagttacgctgggatttagcagaaat
caatcgaaaaaagctgtcactcaaattttaaaaaaggatgacagtttagatgatataatt
aaaaaggctttgaaatttttaagcaggtga

DBGET integrated database retrieval system