KEGG   Thermosipho melanesiensis: Tmel_1140Help
Entry
Tmel_1140         CDS       T00550                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tme  Thermosipho melanesiensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tmel_1140
Enzymes [BR:tme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tmel_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1164132..1164956)
Genome map
AA seq 274 aa AA seqDB search
MSYNEKIDIVCIGKTNLDIFYYYNKFHINNNNISKNFVISPGGKATNVAVNLAKLDLKVR
LISCIGNDIFGNYVKTHLEKILYFTPKIVNTTTAVTSIVVDKMGNNTMFHNIGANKLLSE
DYIPEKIEISFIQTGIPKKVLTTALKNSKVAFVELSEPAQFNDVKNFKPEIISLNLQEIE
RLFEGSLNKKIDKLLNYTNKLLLKMGKDGILYATRKKIIKKEAKKVKVINTTGAGDAVSA
AFLYGYIKMWNIERILDFSLEFAAKKIQSPISTI
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgtcctacaacgagaaaattgatattgtttgtattggaaaaacaaacttagacatattc
tactattacaataaatttcatatcaataataacaacatatcaaaaaattttgtgatatca
cctggtggaaaagcaactaatgttgctgttaaccttgcaaagttggatctaaaagtaaga
cttatatcttgtataggaaatgatatctttggaaattacgtgaaaactcatcttgaaaaa
attctatatttcaccccaaaaattgttaatactacaacagcagttacaagtatagtagta
gataagatgggaaataacaccatgttccataatattggtgcaaataaattactttcagaa
gattacataccagaaaaaattgagatttctttcatacaaacgggtattccaaaaaaagtg
ttaactacagcccttaaaaactcaaaggtagcctttgttgaactttcagaaccagcacaa
tttaacgatgttaaaaactttaaaccagaaataatttcactaaatttgcaagaaatagaa
aggttgtttgaaggtagtctaaataaaaagatagataaacttttgaactatacaaacaaa
ttactgttaaaaatgggcaaagatggaattttatatgcaacaaggaaaaaaattataaaa
aaagaggcaaaaaaagtaaaagttataaatacaacaggagctggagatgctgtttcagct
gcttttttgtacggttacataaaaatgtggaatatcgagagaatattggatttttcctta
gaatttgcagccaaaaaaatccaaagtccaatatctacaatctaa

DBGET integrated database retrieval system