KEGG   Thermosipho melanesiensis: Tmel_1141Help
Entry
Tmel_1141         CDS       T00550                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmel_1141
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmel_1141
   00052 Galactose metabolism
    Tmel_1141
   00500 Starch and sucrose metabolism
    Tmel_1141
   00520 Amino sugar and nucleotide sugar metabolism
    Tmel_1141
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tmel_1141
   00524 Butirosin and neomycin biosynthesis
    Tmel_1141
Enzymes [BR:tme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tmel_1141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1164934..1165860)
Genome map
AA seq 308 aa AA seqDB search
MKIVGVDLGGTFVKIGLVNEKSGKILKKTTIETKVELGGKTVVKRIAEAITNLTNNDFYA
VGIGSPGSIDKERGIVRFSPNFPDWHNFELAPKLSKLLNKNVYVENDANSFVLGEKWFGA
GKGKKHIVALTLGTGVGGGVISHNILITGKDGIGAELGHVIINPNGPLCGCGNYGCLEAY
ASATAIVRMAKERRKKFPDSVIFKDEITAKNIFEAVKLNDRLAVIIRNEVVEALSIGITS
FIHIFNPEVVIIGGGVSRAGEILFEPLRRRVEELVMPTFKGTYKIVQSPLVENAGILGAA
SIVLQREN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgttggtgtagaccttggaggtacttttgtcaaaattggattagtaaatgaa
aaatcaggaaaaatcttgaaaaaaactacaattgaaacaaaagttgaacttggaggcaaa
acagtggtaaagagaatagcagaagcaataactaatctcactaataatgatttttacgca
gtgggaataggctcaccaggctctatagataaagaaaggggaatagtaagattttctcct
aattttccagactggcacaactttgaacttgcaccaaaactttcaaaattgttaaacaaa
aacgtatacgttgaaaacgatgcaaattcttttgttttaggagaaaaatggtttggtgcc
ggaaaaggaaaaaaacatatagtcgctttaacacttggaactggagtgggaggtggtgta
atatcacataatattttaattacaggaaaagatggaattggtgcggaattaggacacgta
ataattaatcctaatggacctctctgtggctgcggaaattacggatgtttagaagcatat
gcttctgctacagcaattgttagaatggcaaaagaaagaagaaaaaaattcccagactct
gttatctttaaagacgaaataacagctaaaaacatatttgaagctgtaaaacttaatgat
agacttgccgtaattataagaaatgaagtggtagaagcattatccatagggattacaagc
tttatccatatattcaatccagaagtggttattataggcggtggagtatcaagagctggt
gaaattttgtttgaaccacttagaagaagggttgaagagcttgtaatgccaacatttaaa
ggtacctacaaaattgtacaaagcccattagtggaaaatgcaggtatattgggggctgca
tccattgtcctacaacgagaaaattga

DBGET integrated database retrieval system