KEGG   Thermosipho melanesiensis: Tmel_1264Help
Entry
Tmel_1264         CDS       T00550                                 

Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmel_1264
   01230 Biosynthesis of amino acids
    Tmel_1264
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmel_1264
   00051 Fructose and mannose metabolism
    Tmel_1264
   00562 Inositol phosphate metabolism
    Tmel_1264
Enzymes [BR:tme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tmel_1264
Exosome [BR:tme04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tmel_1264
  Exosomal proteins of bladder cancer cells
   Tmel_1264
  Exosomal proteins of melanoma cells
   Tmel_1264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1271700..1272422)
Genome map
AA seq 240 aa AA seqDB search
MHKTPTEAAHFASILLNGFVEAKDFEIIVAPPFISIPSVYEILKDSKIKVAAQNMYFEDE
GAFTGEISWKMLKDVGVEYVIIGHSERRNIFNESDEMINKKVLKALEVGLKPIFCIGEKL
EERESSLTFAVIETQIRKGLKDVKDIEKVIIAYEPVWAIGTGKVATSHQAQEVHKFIRKL
ISEMYSPEAAENIRILYGGSIKPNNLFNLIIQPDIDGGLVGGASLKESFIELGKIMNMVI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacaccaaccgaagctgcacattttgcttccattttgttaaacggttttgtc
gaagcaaaagactttgaaataatagttgcaccaccttttatttcaataccttctgtatat
gaaattctaaaggactcaaaaattaaagttgccgcacaaaatatgtactttgaagatgaa
ggcgcattcactggcgagatatcttggaagatgcttaaagatgtgggtgttgaatatgta
ataataggtcatagtgaaagaagaaatattttcaatgaatcagatgaaatgataaacaaa
aaagtacttaaagctcttgaagtagggttaaaacctatcttttgcataggagaaaaacta
gaagaaagagaaagttcactaacttttgcagtaatagaaactcaaataagaaaaggatta
aaggacgtaaaagatattgaaaaagtaataattgcttatgagcctgtatgggcaattggt
acgggaaaagttgcaacatcacatcaagctcaagaagtacacaaattcatacgaaagcta
atttcggaaatgtatagtccagaagccgctgaaaatattagaatactatacggtggaagt
attaaaccaaataacctcttcaatctcataatacaaccagatatagatggaggattggta
ggtggagctagtttaaaagaaagtttcattgagcttggcaaaataatgaacatggtgata
taa

DBGET integrated database retrieval system