KEGG   Thermosipho melanesiensis: Tmel_1324Help
Entry
Tmel_1324         CDS       T00550                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tme  Thermosipho melanesiensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tmel_1324
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tmel_1324
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tmel_1324
Enzymes [BR:tme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tmel_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1332939..1334147)
Genome map
AA seq 402 aa AA seqDB search
MYKLRCISCGKLFEPSPSLYTCDKCGQRYGTLEVIYDYEKLNIKKTHFDKCGDISQFKHL
LPITNYPVIQKVGNTPVLSFKNFFGIKNVIFKYDGTNPTGSYKDRATTIAIAKAYEYGYN
TIYCASTGNAASSLAGLSSTTKLKTYIFVPSNIPPAKLSQLVVYGARVIQIDGNYDTAFE
FSIKVGEKLNWYSRNSAINPYLLEGKKTGALELVVQFDFKVPDVVFVSAGDGTVISGIFK
GFYDFYKLNIINKIPKIIGVQAEGADSIVKTFENGKPYTPVDIIPHTIADSISVGKPRDV
IKACKYVEKSRGKFLRVSDSEIKNAIFELAQKTGIFAEPAGAAAYAGFKKALEYKLLSKE
NTVAIFITGNGLKDISPIMNNLNIQKVNPNLKEILDFIEVIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattaagatgtatatcttgcggaaaattatttgaaccttctccatcattatac
acatgtgataaatgtggccaaagatatgggacacttgaggtaatatacgactatgaaaaa
ctaaatattaaaaaaacacattttgataagtgtggggatatttcacaatttaaacaccta
cttcctattaccaattatccagttatacaaaaagttggaaatactcctgtattatctttt
aaaaatttctttggaatcaaaaatgtaatttttaaatacgatggaacaaatccaactggc
tcatacaaagatagagcaactaccatcgctattgcaaaagcatacgaatatggttataat
accatttattgcgcttctaccgggaatgcagcaagttcgctagctggtctttcttctacc
acaaaacttaaaacgtatatattcgttccttcgaatattcctccagcaaaactttcacaa
ttggtagtttacggggcaagagtaattcaaatagatggaaattatgatactgcttttgaa
ttttctataaaagtaggagaaaaactaaattggtattctagaaattctgcaattaatcct
tatttacttgaaggaaaaaaaaccggtgcattagaactagtagttcaatttgattttaaa
gttccagatgtggtatttgttagtgctggtgatggaactgtaataagtggaattttcaaa
ggattttatgatttttacaaattaaatataataaacaaaattccaaaaattattggtgtt
caagcagaaggagcagattcaattgtaaaaactttcgaaaatggaaaaccatacactcct
gttgacataattccccatactatagctgacagtatctctgtaggaaaacccagagatgtc
attaaagcatgtaaatatgtagaaaaaagtaggggcaaatttttaagagtttcagatagt
gaaattaaaaacgccatatttgaacttgcgcaaaaaacgggaatatttgcagaacctgca
ggtgccgctgcttatgcgggattcaaaaaagccttagaatataaattactttctaaagaa
aatacagtagctatatttattaccggaaacggattaaaagacattagccctataatgaat
aatttaaacattcaaaaagtcaacccaaatctaaaagagattttagacttcattgaggtg
ataaaatga

DBGET integrated database retrieval system