KEGG   Thermosipho melanesiensis: Tmel_1770Help
Entry
Tmel_1770         CDS       T00550                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tme  Thermosipho melanesiensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tme02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tme02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1756818..1757852
Genome map
AA seq 344 aa AA seqDB search
MEEKIKVLIVDDSAFMRMILKDVIEKENDMKVVGIAKDGLEAVELAIKTKPDVITLDVEM
PKLNGIEALKEIMKRAPARVIMVSSLTEEGADITITALELGAVDFITKPAGSISMNFRKV
AGDLIKKIRNSMQIDINALVRKALYKPKTLNVKSLVSGKVVVIGSSTGGPKSLDQVIPPL
PANFPAPIILVQHMPAGFTKSLANRLNKISNLNVKEAEEGDILKPGWVYIAPGDYHLGIK
LHDKKSIVYLEKSEKINNVRPAVDFTLDKVAEIYKDKTVSVILTGMGKDGTKGAFKVKYY
KGIVIAESKETCVVYGMPKSVIEEGYADFVLPAYKIPEKLVEII
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaataaaggtattaatcgttgacgattctgcttttatgagaatgatttta
aaagatgtcatagaaaaagaaaatgacatgaaagttgttggtattgctaaagatggcctt
gaagctgttgagcttgcaataaaaactaaacctgacgttattacgctagatgttgaaatg
ccaaaattaaatggaattgaagcattaaaggaaattatgaaacgtgcacctgcaagagta
ataatggtaagtagccttactgaagaaggcgcagatattacaattactgcacttgagctt
ggtgctgttgattttattaccaaaccagccggcagtatctctatgaattttagaaaagtt
gctggagatttgattaaaaaaataagaaattctatgcaaattgatattaatgctctagta
agaaaagctctatataagccaaaaacactgaacgtcaaatcacttgtttctggaaaggtt
gttgtaattggctcatcgactggtggaccgaaatctcttgatcaagttattcctccactt
cctgctaactttccagctccaattatattagttcaacatatgccagcgggttttacaaaa
tcattggcaaatagactaaataaaatatcaaacttaaatgttaaagaagcagaagaggga
gatattttaaaaccaggatgggtatatatagctcctggggactatcatcttggaattaaa
ttgcacgataaaaaaagtattgtttacctagaaaaaagcgaaaagataaataatgttaga
ccagcagttgattttactttggataaagttgctgaaatttacaaggataaaaccgtttca
gttatcttaaccggtatggggaaagatggaaccaaaggagcattcaaagtaaaatattat
aaaggtattgtaattgccgaatcaaaagaaacttgtgtagtttacggtatgcctaaatct
gttattgaagaaggttatgccgattttgtgttacctgcatacaaaatacctgaaaaactt
gttgaaataatctag

DBGET integrated database retrieval system