KEGG   Thermosipho melanesiensis: Tmel_1863Help
Entry
Tmel_1863         CDS       T00550                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tme  Thermosipho melanesiensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tmel_1863
Enzymes [BR:tme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tmel_1863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1847992..1848804)
Genome map
AA seq 270 aa AA seqDB search
MIVGIGIDIIDIGRISLKIADRILTGLEKGKKLNAQYLAGRFSLKEAFFKALGTGLNGNS
FKDISILNNDEGKPYIVLHKDFEGFNFCHVSLSHDTFALSNVILEKRQGNVFLGIGTNLG
EKEKNLSTALDYLEKVGIKILKTSSIYITKPYGYTNQDNFYNIVVEIDTVLSPKKLLECL
LKIEKNMGRKRTIKWGPRIIDIDILFYGNLVIDLEKLKIPHYDFVNRDFFVVPMVEISKD
FVHPKFGKTIESLMGNFEKNWEVIDWKLRR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
ttgattgttggaattgggattgacattattgatattggacgtatatcgttaaaaattgcc
gataggatactaacaggattggaaaaaggaaagaaattaaacgcccaatatctagctggg
cgtttttctctaaaagaggcattttttaaagcacttggaacaggtcttaatggtaattct
tttaaggatatttcgattttgaataatgatgagggaaaaccctatattgttttacataaa
gattttgagggatttaatttttgtcatgtttcactttctcatgatacatttgcgctttca
aatgttattttagaaaaacgtcaaggaaatgtttttcttggaattggtacaaatttaggt
gaaaaagaaaaaaatttatcaactgcattagattacttggaaaaggttgggataaaaata
ttaaaaacttcaagtatttatattaccaaaccatatggatataccaatcaagataatttc
tacaatatagttgttgaaattgatacagttctgagtccaaaaaaacttttggaatgttta
ttaaaaattgaaaaaaacatggggcgaaaaagaacgataaagtgggggccaagaataata
gatattgatattctattttatggaaatcttgtaattgatttagaaaaattaaaaatacca
cattatgattttgtaaatagggatttttttgttgttcctatggttgaaatatctaaagat
tttgtacatcctaaatttggaaaaactattgaatctttgatgggaaatttcgagaaaaac
tgggaggtaatagattggaagttgagaagataa

DBGET integrated database retrieval system