KEGG   Thermosipho melanesiensis: Tmel_1870Help
Entry
Tmel_1870         CDS       T00550                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tme  Thermosipho melanesiensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tme01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tme00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tme00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1855236..1856252
Genome map
AA seq 338 aa AA seqDB search
MKIYEFVGKQLFKEHGVKIPEGYLVTSKDELTIKFLPAVLKSQVLVGGRMKAGGILFANN
QREFYDYGNILLKKNIKGEKPYGILIEKMINIKREYYLSMYIDKLEKDFMILFSEYGGIN
IEENADKVIKINFDKYKVLPKKFHKIILTLYKLMKEKDLTLIEINPLAETLNGDLIALDA
VLHLDDNSIFRQKWAKQFSSETQPFHFVKLNGDIGIIGCGAGIVMATMDAVTFYGGKPAN
FLDLGGGADTKTTTLALEYLKNLSINKIIMNIFGGITKCDEIAQAIVRFKQKNPQISLYV
RLTGTNEEIAKQILKKYNIELFSDMYEMIECAVKEEKK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttatgaatttgtggggaaacagctctttaaagaacatggtgtaaaaattcca
gaaggttatttagtaacttctaaagatgagttaaccataaaatttcttccagctgtttta
aaaagtcaagtattagttggagggagaatgaaagctggtggaattctctttgcaaataat
cagagagaattttatgattatggaaatattctattgaaaaaaaatataaaaggtgaaaaa
ccatacggaatattaattgaaaaaatgattaatataaaaagggaatattatttatcaatg
tatatcgataaattggaaaaagattttatgatactcttctcagaatatggcggaataaat
atagaagaaaacgcagataaagttattaaaataaactttgacaaatataaagtacttccc
aaaaaatttcacaaaattattctaacattatacaaactcatgaaagaaaaagatttaaca
ctaattgaaatcaaccctttagccgaaactttaaatggtgatttaattgcattagatgct
gtattacatttagatgacaattctatttttagacaaaaatgggctaaacaattttcctct
gaaacacaaccttttcatttcgtaaaactaaatggtgatattggaataatcggttgtggt
gctggaattgtaatggctacaatggatgccgtaacattttatggtggaaaaccagcaaac
ttccttgatcttggtggtggagcagataccaaaactacaactctagcactcgaatattta
aaaaatctttcaattaacaaaataataatgaatatctttggtggaattacaaaatgcgat
gaaattgctcaagctattgtcaggtttaaacaaaaaaatcctcaaatatcactatacgtt
agattaactgggacaaatgaagaaattgctaaacaaattttaaaaaaatacaatattgaa
ttatttagcgatatgtacgaaatgattgaatgtgcagtaaaggaggagaaaaaatga

DBGET integrated database retrieval system