KEGG   Thermosipho melanesiensis: Tmel_1870Help
Entry
Tmel_1870         CDS       T00550                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tme  Thermosipho melanesiensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tmel_1870
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tmel_1870
   00640 Propanoate metabolism
    Tmel_1870
   00660 C5-Branched dibasic acid metabolism
    Tmel_1870
Enzymes [BR:tme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tmel_1870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1855236..1856252
Genome map
AA seq 338 aa AA seqDB search
MKIYEFVGKQLFKEHGVKIPEGYLVTSKDELTIKFLPAVLKSQVLVGGRMKAGGILFANN
QREFYDYGNILLKKNIKGEKPYGILIEKMINIKREYYLSMYIDKLEKDFMILFSEYGGIN
IEENADKVIKINFDKYKVLPKKFHKIILTLYKLMKEKDLTLIEINPLAETLNGDLIALDA
VLHLDDNSIFRQKWAKQFSSETQPFHFVKLNGDIGIIGCGAGIVMATMDAVTFYGGKPAN
FLDLGGGADTKTTTLALEYLKNLSINKIIMNIFGGITKCDEIAQAIVRFKQKNPQISLYV
RLTGTNEEIAKQILKKYNIELFSDMYEMIECAVKEEKK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttatgaatttgtggggaaacagctctttaaagaacatggtgtaaaaattcca
gaaggttatttagtaacttctaaagatgagttaaccataaaatttcttccagctgtttta
aaaagtcaagtattagttggagggagaatgaaagctggtggaattctctttgcaaataat
cagagagaattttatgattatggaaatattctattgaaaaaaaatataaaaggtgaaaaa
ccatacggaatattaattgaaaaaatgattaatataaaaagggaatattatttatcaatg
tatatcgataaattggaaaaagattttatgatactcttctcagaatatggcggaataaat
atagaagaaaacgcagataaagttattaaaataaactttgacaaatataaagtacttccc
aaaaaatttcacaaaattattctaacattatacaaactcatgaaagaaaaagatttaaca
ctaattgaaatcaaccctttagccgaaactttaaatggtgatttaattgcattagatgct
gtattacatttagatgacaattctatttttagacaaaaatgggctaaacaattttcctct
gaaacacaaccttttcatttcgtaaaactaaatggtgatattggaataatcggttgtggt
gctggaattgtaatggctacaatggatgccgtaacattttatggtggaaaaccagcaaac
ttccttgatcttggtggtggagcagataccaaaactacaactctagcactcgaatattta
aaaaatctttcaattaacaaaataataatgaatatctttggtggaattacaaaatgcgat
gaaattgctcaagctattgtcaggtttaaacaaaaaaatcctcaaatatcactatacgtt
agattaactgggacaaatgaagaaattgctaaacaaattttaaaaaaatacaatattgaa
ttatttagcgatatgtacgaaatgattgaatgtgcagtaaaggaggagaaaaaatga

DBGET integrated database retrieval system